KEGG   Xiphophorus maculatus (southern platyfish): 102223121Help
Entry
102223121         CDS       T02923                                 

Definition
(RefSeq) nuclear receptor coactivator 3 isoform X1
  KO
K11256  nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102223121
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102223121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NCOA_u2 SRC-1 PAS_11 DUF4927 Nuc_rec_co-act PAS PAS_3 PAS_9 HLH PAS_4 PAS_2
Motif
Other DBs
NCBI-GeneID: 102223121
NCBI-ProteinID: XP_023188379
Ensembl: ENSXMAG00000017470
Position
1
AA seq 1516 aa AA seqDB search
MSGLGDNSMEPLSSENRKRKLSTCDTPGLGCERKRREQESKYIEELAELISANLSDIDSF
NVKPDKCAILKETVRQIRQIKEQGKASSNDDDVQKSDVSSTGQGVIDKDHLGPLLLQALD
GFLFVVNREGSIVFVSDNVTQYLQYKQEELINTSVYNILHEEDREEFHKNLPRTNINGVS
WGNEATRQKSHTFTCRMLVKFGHAHGPMEEGPGGPRYETMQCFALTQPKAMIEEGEDLQS
CMICVARRVTAVERTESFNTRHELSGKLIQIDQSSLRASMRPGWEDLLRRCIQMFLQHSD
GQPWSHKRHYHEAFLQGHAETPLYRFSLSDGTPVTAQTKSKLYRHPMSNEPQGFISTHLL
QREPNGYRSAPGGNMMPNNMRHQGMGNANMNPQMNVNAGGGMGMGGMGGMNRGFGMSEQS
HMGHMGPMGGGSVYGGNGGGGSGGGGLGSRMMQMNQMNQMNQVGHMNQMSQMGPMNHPGP
GMQQHPQQQPPFQSAGGFGLSGMNSPSGSPRMGGPQPGLLMSPRNRGSPKMGANQFSPGG
MHSPMSGLGGGGAAGGNTCTFSSSSLNALQAISEGVGSSLPSTLTSPSAAHKPDSSPSIH
SSSQPSHQAKPGQDGSKSPAGGLGPGPGDHHLPVHHHHHQHPQAESSAERPDSQAATAAK
ECGEASGEAGMAGTDPPRRLPDSKGHKKLLQLLTSPTEELGISGSGPTGPAGPPPPNSSG
ASAGSDSKEATGGMTSPSSTGVSSSSASGGTGPAPGQGGASASAHYTGSLQEKHKILHKL
LQNGNTPDEVAKITAEATGKVTLGGQESGEGAAGSSAAGSGPGLIADPKQEQHSPKKEKT
HALLHYLLNKDDSKEQTDVKPKLEDLEGKCLPGAGGGGGGGPVAEHAESKIKSEPPDDLH
NLESILGDLRGSSSDFYPDQTGGAGANNTGNKPQGCLDDGLQGSPVMGPGPRGPFQRTMS
LDGKPLGGPGGAVRRPMLIKQENMMGSPDSFPGNMGPINRGAGPQRSPMGGSGDWKPRSS
ISPVSSAGHPSMMRPGMEYNNGKSVMSGPMVSRSNSVPGNRSMLQQQLMDMGGSSDMGMG
MSPFSQQGQPSQSPSWHEPMMNMEGNRRQFGNPLDDLLVPPTTSEGQSDERALLDQLDSL
LNNTDGIALEEIDRALGIPDLVSQTQGAEQQLEHFGGQDPSMLLDQKPLYGAGYPGPPAM
PMQSGYGGNPMQGQGQQAGFGPMLSPMGQGGSFPGMGGMGGMGHPRANMMRPRMMNANKP
MRLQLQQRLQGQQFMNQTRQGMAMKMENPGGNPGMRPGMQPGMGGQQGFLNAQMMVQRNR
DVVNLHMRRQRMMMLMQQQQQQAAAAAAAAAGGFSPPPNVTAPGGMDSPMGGPNMGQPGP
QQFGYGGSYGVTQQGDPSFGPSGGSPPNAMMPGRMGPQNPMMQQHSQGGPMYPGADMKGW
SQGSMGRNSSYPQQQFGPQASLGQQQFGQQGNPGQYGGMMMNGGMPASGGGGHMGQMGMN
PMVMGRMPMGPDQKYC
NT seq 4551 nt NT seq  +upstreamnt  +downstreamnt
atgagcggactgggggacaactccatggagcctctgagctcggaaaaccgcaaacgcaaa
ctgtccacttgcgacacgcctggtctggggtgtgagaggaagcgtcgggagcaggagagc
aagtacatcgaggagctggccgagctgatctcggccaacctcagcgacatcgacagcttc
aacgtcaaaccggacaaatgtgccatcctcaaagagacggtgcgccagatccgccagatc
aaggagcaaggaaaagcttcatccaacgatgacgacgtccagaaatcagacgtgtcgtca
accggtcagggggtcattgacaaggaccaccttgggccgcttctactgcaggctctggac
ggctttctgtttgtggtgaaccgggagggcagcatcgtgttcgtgtccgacaacgtcacc
cagtacctgcagtacaagcaggaggagctcatcaacaccagcgtgtacaacatcctgcat
gaggaggaccgcgaggaatttcacaagaacctgcccaggaccaacataaatggcgtgtcg
tgggggaatgaggcgactcgacagaagagtcacactttcacctgccggatgctggtcaaa
tttggccacgcccacggcccaatggaggaggggccaggaggaccgcgctacgagacaatg
cagtgttttgctctcacacagcccaaagccatgatcgaagagggagaagaccttcagtca
tgtatgatctgcgtggcccgtcgggtcacagccgtggagcggaccgagagtttcaacacc
cgacatgagctgtcaggtaaactgattcagatcgaccagagctccctgcgagcgtccatg
cgtccaggctgggaagatttgttgcggcgctgcatccagatgttccttcagcacagcgac
gggcagccgtggtcgcacaagcggcactatcacgaggcttttctccagggtcatgccgag
acacccctgtaccgcttctccctgtctgacggcaccccagtaacagcccagaccaagagc
aagctgtaccgacaccccatgagtaacgagccgcaaggattcatctccactcacctgctg
cagagggaacccaatggttaccgctcggcaccaggcggcaacatgatgcccaacaacatg
aggcatcaagggatgggtaacgccaacatgaacccccagatgaacgtgaatgcaggcggc
gggatggggatgggaggaatggggggcatgaaccggggcttcggcatgagcgagcagagc
cacatgggccacatgggtccgatgggaggcggctctgtgtacggagggaacggcggagga
ggaagtggtggcggaggcctgggcagccgcatgatgcagatgaatcagatgaaccagatg
aatcaggtggggcacatgaatcagatgagtcagatgggtcccatgaatcaccccgggccg
ggcatgcagcagcacccgcagcagcagcccccgttccagagcgccggaggcttcgggctc
agtgggatgaacagtccgtcagggagccccaggatgggcggcccccagccaggactgctg
atgtccccccggaaccggggaagcccaaagatgggggccaaccagttctcacctggagga
atgcactctcctatgagcggcctcggcggtggaggagcagccggaggcaacacctgcacc
ttctccagcagctctctgaacgctctccaagccatcagcgagggagtcgggagctcgctc
ccctccactctgacgtccccctcagcagcccacaaaccagacagctctcccagcatccat
tcctcctcccagcccagtcatcaagctaaaccaggacaagatggctccaaaagtccggct
gggggcttggggcccggacccggagaccaccacctcccggtgcaccaccaccatcatcag
catcctcaggcggagagttctgcagagcgaccggacagccaggcagctacagcagctaaa
gagtgtggagaagcaagcggcgaggcggggatggcgggcacagacccccctcggaggctg
ccggacagcaaaggacacaagaagttgctgcagctgttgacttccccaaccgaggagctg
gggatcagtggaagcggacctacggggcccgctggacctcctccaccaaacagcagcggc
gcttcagcggggtcagacagcaaagaagccactggcgggatgaccagcccttcctccaca
ggggtctcctcctcctcagccagcggcggcacggggccggcgcccggccagggcggcgca
tcggcctcagctcactataccgggtcgctgcaggagaagcacaaaattctccacaagctt
cttcagaacggcaacactccggatgaagtcgctaagatcacagcagaggcgacggggaaa
gtgacgctcggaggccaggagagtggcgaaggtgcagctggaagctcggcggccgggtcg
ggccctgggttgatcgcggaccccaaacaggagcagcacagcccgaagaaggagaagacc
cacgctctcctccactatctcctcaacaaggacgactccaaagaacaaacagacgtgaag
cccaaacttgaagatctagaagggaaatgtcttcctggagccggcggcggcggcggcggc
ggccctgtggcggagcatgctgagagcaagatcaaatcagaacctcctgatgatttgcac
aacctggagtctattctgggtgatctcaggggttcaagctccgacttttaccctgatcag
actggaggtgccggggcaaacaacacaggaaacaaaccacaggggtgccttgatgacggc
ctgcaggggagtccagtaatgggtccaggacctcgagggcccttccagaggaccatgtcc
ttggatgggaagccactgggcgggcctggaggggctgtaagacgtccgatgctcatcaag
caggagaacatgatgggcagcccagacagcttcccaggaaacatggggccaatcaataga
ggcgcaggcccccagaggtctcccatggggggctctggggactggaagcctcgttccagc
atcagccctgtgagttcagcaggacatccatccatgatgcgcccaggcatggagtacaac
aacgggaagagcgtgatgtcaggacccatggtcagccgctccaacagcgtgccgggcaac
aggtcgatgctgcagcagcagctcatggatatgggaggttcttctgatatgggcatgggt
atgagtcccttcagccagcagggccagcctagccagtccccatcctggcatgaacccatg
atgaacatggagggaaacagacgccagtttggcaaccccttagatgatcttctggttcct
cccaccaccagtgagggtcagagcgatgagagggcgcttctagaccagctggattcgctg
ctgaacaacaccgacggcatcgctctggaggagatagaccgagctcttggtatcccagac
cttgtcagccagacccagggagcagagcagcagctggagcattttggaggacaggaccca
tccatgctgcttgaccaaaagcctctgtatggagcaggctatcccggaccccctgctatg
ccaatgcagtctggctacggagggaaccccatgcaggggcagggccagcaggccgggttt
gggcccatgctctcaccgatgggccaaggcgggagctttcccggtatgggtgggatgggc
ggcatggggcatcctcgagccaacatgatgcgacccaggatgatgaacgccaacaagccc
atgaggctgcagctgcagcagcggctccagggacagcagtttatgaatcagacacggcag
ggcatggcgatgaagatggagaacccaggagggaaccctggcatgaggcctggcatgcag
cctggcatgggaggacagcagggcttcctaaatgctcagatgatggttcagcgtaacaga
gacgttgtcaacttgcacatgaggaggcagcgcatgatgatgctgatgcagcagcaacag
cagcaggcagcagcagccgctgcagcagctgcaggggggttcagtccgcctccgaacgtc
acggctccagggggcatggatagccccatgggggggccaaacatgggccagccgggaccg
cagcagtttggctacggtgggagctatggcgtgacccagcaaggtgacccctcttttggc
ccatcaggtggaagtccgcccaatgccatgatgccagggcgcatggggcctcaaaacccc
atgatgcaacagcactcacagggggggcctatgtacccaggagctgatatgaaaggctgg
tcacagggcagcatgggacgcaacagttcataccctcagcagcagtttgggccgcaggca
tcgcttggtcagcagcagttcggacagcagggaaatcccgggcaatacggaggcatgatg
atgaacggcggcatgccggccagcggaggaggtggtcacatgggacagatggggatgaac
ccaatggtgatggggcgcatgcctatggggcctgatcagaaatactgctga

DBGET integrated database retrieval system