KEGG   Xiphophorus maculatus (southern platyfish): 102223232Help
Entry
102223232         CDS       T02923                                 

Definition
josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102223232
Peptidases [BR:xma01002]
 Cysteine Peptidases
  Family C86
   102223232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 260 aa AA seqDB search
MGSTPHPASEWKEKGRGGLQELGCMPWKVSKQKAAGGGGEAVSGAVERRSKDPRDGQLQQ
DLSSSSSSLSPPAPQQTSPTTPAIYHEKQRRELCALHALNNVFQDGTAFSRDTLQEIYQR
LCPSTMVTPHKKSMLGNGNYDVNVIMAALQTRGFEAVWWDKRRDVGSIELSNVEGFILNV
PSNLRWGPLRLPLKRQHWIGVREVGGAYYNLDSKLRNPQPIGSPDELRKFLRQQLRGKNC
ELLLVVSEEVETHQTWRSDG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtactccgcatccagccagtgagtggaaggagaagggccgaggcgggctgcag
gagctgggctgcatgccctggaaggtcagcaagcagaaagctgccggaggagggggggaa
gcggtttcaggagcagtggagaggaggagcaaggatccgagggacggtcagctgcagcag
gatctctcgtcgtcgtcgtcctccctctccccgccggctccccagcagacttctccgaca
actccggccatatatcacgagaagcagcggagggagctgtgcgcattgcatgcgctcaac
aacgtcttccaggatgggacggcctttagtcgggacaccctgcaggagatctaccaaagg
ctatgtcccagcactatggtgacgcctcacaaaaagagcatgctgggaaacgggaactat
gatgtaaacgtcatcatggcggcattgcagacccgagggtttgaggcagtctggtgggat
aaaagaagggatgtaggcagcattgagctgtccaacgtggagggctttatcctgaacgtg
ccgtccaatctgcgctgggggcccctccggctgccacttaaacgccagcactggattgga
gtcagggaggtgggaggtgcctactataacctggattctaagctacgcaaccctcagcct
attggcagtcctgatgagctcaggaagtttctccgtcagcagctgcgagggaagaactgt
gaactcctgctggttgtctcagaagaggtggagacccaccaaacgtggcgctccgacggc
tga

DBGET integrated database retrieval system