KEGG   Xiphophorus maculatus (southern platyfish): 102223994Help
Entry
102223994         CDS       T02923                                 

Definition
alkaline phosphatase, tissue-nonspecific isozyme-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102223994
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102223994
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102223994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 534 aa AA seqDB search
MEWTRVALVALVLLVTLGSSRAKVEEENPEFWRSKATQTLQSVLDRKLNTNVAKNVILFL
GDGMGITTYTAARILKGQLQDQTGEETVMTMDTFPHVGLAKTYSVDFQIPDSAATATAYL
CGVKTNLNTIGVNAATRNGVCKTQKGNEVTSILKWAKDAGKSVGIVTTTRVQHATPAAAY
AHSASRSWYGDADMPDAAKRDNCTDIASQLIENIDIDVIIGGGRKYMTPRGTKDPEYSSD
LSSWGTRRDGRNLIQEWQSMKTGKVAHYVWNKSDFDAVDPEATDYLMALFEPGDLRYEVE
RDPSTDPSIVETTEKAIQILQKNPRGFFLLVEGGRIDQAHHAGRAYMALHEAVAFDNAIA
KGLELTKEDETLTIVTADHSHPLTFNGFPFRGQSILGKSPLWGTDFLPYTTLMYGNGPGH
KIINGKRPDIRNVATKDKNYVQLSAVPVGSTTHSGEDVAVLARGPMSHLFSGVQEQNYIA
HAMGYAACVGADLRHCNGGSIPPANSSKKSGAVQTSSALFSSLLSLLLALTVIM
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggagtggacaagagtggcccttgtagctctggttctgctggtaactctgggatcgtca
agagccaaggttgaggaggagaaccccgagttctggaggtcaaaggccacacagactcta
caatcagtcctggacagaaaactgaacaccaatgttgccaagaacgtcatccttttcctt
ggggatggaatgggaattacaacctacactgctgcccgaatcctcaaggggcagctacag
gaccagactggagaggaaacagtgatgaccatggacaccttcccacacgtggggctggct
aagacctacagtgtagacttccagatcccagacagtgcagccacggccacagcgtatttg
tgtggagtaaaaaccaacctgaacaccatcggagtcaatgcggcgactcgcaacggggtc
tgcaaaactcagaaagggaatgaggtcacctccattctgaagtgggccaaagatgctggt
aagtctgttggtattgtaacgaccacacgggtgcagcacgccaccccagcagctgcctac
gcccacagtgccagcaggtcatggtacggcgatgcagacatgcctgatgcggccaaaagg
gacaactgcaccgatatcgcatcgcagcttatcgaaaacatagacatcgatgtgatcatt
ggtggaggcagaaagtacatgacacctcggggcaccaaagacccagaatactcctcggat
ttgtcttcctggggcacaagaagagatggacgaaacctaatccaggagtggcagagcatg
aaaacaggaaaggtagcccactatgtgtggaataaaagtgattttgatgctgttgaccct
gaagccactgactacctcatggctctgtttgaacccggggatctgcgttatgaggtggag
agggatccaagcactgatccgtctattgttgagaccacagaaaaagcaatccagatcctg
cagaaaaacccaagaggtttcttcctactagtggaggggggaagaattgaccaggcccac
cacgccggccgggcctacatggccctacatgaggctgttgctttcgataacgccatcgcc
aagggcctcgaactcacaaaagaggacgaaactctcactatagtgacggccgaccactcc
caccctctgaccttcaatggattcccctttcgagggcagagcattctgggtaaatctcct
ctgtggggtacagactttttaccctacaccactctgatgtacggcaacggaccaggtcac
aaaatcattaacggcaagcgaccagacattcgaaatgtcgccacaaaagataaaaactac
gtccagctctctgccgtccccgtaggctcgaccacccacagcggggaggacgtggcagtg
ctggcccgtggacccatgtctcacctcttcagcggggtccaggagcaaaattacatagcc
cacgctatgggctatgctgcctgcgtgggggccgacctgaggcactgcaatggagggtct
ataccacctgcgaactccagcaaaaagtctggggcagttcagacctcatcagctctgttc
agcagcctcctcagtttgctgctggccctaactgtgatcatgtaa

DBGET integrated database retrieval system