KEGG   Xiphophorus maculatus (southern platyfish): 102224103Help
Entry
102224103         CDS       T02923                                 

Definition
(RefSeq) creatine kinase S-type, mitochondrial-like
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00330  Arginine and proline metabolism
xma01100  Metabolic pathways
Module
xma_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102224103
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102224103
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102224103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 102224103
NCBI-ProteinID: XP_005813120
Ensembl: ENSXMAG00000001254
UniProt: M3ZGC6
Position
8
AA seq 417 aa AA seqDB search
MSGSFRRLISGRGTAVLLASLGAGTVATGVLLNENSSLAAEARKKLYPPSSDFPDLRKHN
NCMATALTPAVYAKLRDKVTPNNWTLDQCIQTGVDNPGHPFIKTVGCVAGDEESYEVFAE
LFDPIIKDRHNGYDPRTMRHPTDLDASKLKHGMFDENYVLSSRVRTGRSIRGLSLPPACS
RAERREVERVVVTALAGLKGDLAGRYYGLGDMTEKEQQQLIDDHFLFDKPVSPLLTCAFM
ARDWPDARGIWHNNEKTFLIWVNEEDHTRVISMEKGGNMKRVFERFCSGLKQVEHLIQER
GWEFMWNERLGYVLTCPSNLGTGLRAGVHVRLPNLSKDPRFSKILDNLRLQKRGTGGVDT
AATGDTFDISNLDRLGKSEVELVQLVVDGVNYLIECEKKLEKGQDIQVPAPLVMFKK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctccttcaggcgtctgatctcgggccgcggcacggccgtgctgctggccagc
ctgggcgcgggcaccgtggccaccggcgtcctgctgaacgagaacagctccctggctgcc
gaggccaggaagaagctctaccctcccagctcagacttccctgacctgaggaaacacaac
aactgcatggccaccgctctgactccggccgtttacgccaaactgagggacaaggtgact
cccaacaactggaccctcgaccagtgcatccagaccggggtggacaacccgggtcacccc
ttcatcaagacggtgggctgtgtcgctggcgacgaggaaagctacgaggtgtttgctgaa
ctctttgatccgataatcaaagacagacacaacggctacgaccccagaaccatgagacac
cccacagacctggacgcctctaagctaaaacacgggatgttcgacgagaactacgttctg
tcgtcgcgcgtccggacgggccgcagcattcgtgggctgagcctccccccggcctgttcc
agggccgagcggcgtgaggtggagcgggtggtggtgaccgctctggccggcctgaaggga
gacctcgccggccgctactacggcctgggcgacatgacggagaaagagcagcagcagctt
attgatgaccacttcctgtttgacaagcccgtctcccctctgctgacgtgcgccttcatg
gccagagactggccagacgccagggggatctggcacaacaatgagaagaccttcctgatc
tgggtcaatgaggaagaccacaccagagtcatctccatggagaagggcggcaacatgaag
agagtgtttgagagattctgcagtggcctcaaacaggttgagcatctgatccaggagaga
ggctgggaattcatgtggaatgagcgtctgggatacgtcctcacatgcccgtccaacctg
ggcacgggcctccgggccggggttcatgtccgcctgccaaacctcagcaaggacccgcgt
ttctccaaaatcctggacaacctgcggctgcagaagcgaggcacgggcggagtggacacg
gcggccaccggagacaccttcgacatttccaacctggaccgtctgggcaaatccgaggtg
gagctggttcagctggtggtcgacggggtcaactacctgatcgagtgcgagaagaagctg
gaaaagggccaggacatccaggtgcccgctccgctggttatgttcaagaagtga

DBGET integrated database retrieval system