KEGG   Xiphophorus maculatus (southern platyfish): 102224103Help
Entry
102224103         CDS       T02923                                 

Definition
creatine kinase S-type, mitochondrial-like
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102224103
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102224103
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102224103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 417 aa AA seqDB search
MSGSFRRLISGRGTAVLLASLGAGTVATGVLLNENSSLAAEARKKLYPPSSDFPDLRKHN
NCMATALTPAVYAKLRDKVTPNNWTLDQCIQTGVDNPGHPFIKTVGCVAGDEESYEVFAE
LFDPIIKDRHNGYDPRTMRHPTDLDASKLKHGMFDENYVLSSRVRTGRSIRGLSLPPACS
RAERREVERVVVTALAGLKGDLAGRYYGLGDMTEKEQQQLIDDHFLFDKPVSPLLTCAFM
ARDWPDARGIWHNNEKTFLIWVNEEDHTRVISMEKGGNMKRVFERFCSGLKQVEHLIQER
GWEFMWNERLGYVLTCPSNLGTGLRAGVHVRLPNLSKDPRFSKILDNLRLQKRGTGGVDT
AATGDTFDISNLDRLGKSEVELVQLVVDGVNYLIECEKKLEKGQDIQVPAPLVMFKK
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctccttcaggcgtctgatctcgggccgcggcacggccgtgctgctggccagc
ctgggcgcgggcaccgtggccaccggcgtcctgctgaacgagaacagctccctggctgcc
gaggccaggaagaagctctaccctcccagctcagacttccctgacctgaggaaacacaac
aactgcatggccaccgctctgactccggccgtttacgccaaactgagggacaaggtgact
cccaacaactggaccctcgaccagtgcatccagaccggggtggacaacccgggtcacccc
ttcatcaagacggtgggctgtgtcgctggcgacgaggaaagctacgaggtgtttgctgaa
ctctttgatccgataatcaaagacagacacaacggctacgaccccagaaccatgagacac
cccacagacctggacgcctctaagctaaaacacgggatgttcgacgagaactacgttctg
tcgtcgcgcgtccggacgggccgcagcattcgtgggctgagcctccccccggcctgttcc
agggccgagcggcgtgaggtggagcgggtggtggtgaccgctctggccggcctgaaggga
gacctcgccggccgctactacggcctgggcgacatgacggagaaagagcagcagcagctt
attgatgaccacttcctgtttgacaagcccgtctcccctctgctgacgtgcgccttcatg
gccagagactggccagacgccagggggatctggcacaacaatgagaagaccttcctgatc
tgggtcaatgaggaagaccacaccagagtcatctccatggagaagggcggcaacatgaag
agagtgtttgagagattctgcagtggcctcaaacaggttgagcatctgatccaggagaga
ggctgggaattcatgtggaatgagcgtctgggatacgtcctcacatgcccgtccaacctg
ggcacgggcctccgggccggggttcatgtccgcctgccaaacctcagcaaggacccgcgt
ttctccaaaatcctggacaacctgcggctgcagaagcgaggcacgggcggagtggacacg
gcggccaccggagacaccttcgacatttccaacctggaccgtctgggcaaatccgaggtg
gagctggttcagctggtggtcgacggggtcaactacctgatcgagtgcgagaagaagctg
gaaaagggccaggacatccaggtgcccgctccgctggttatgttcaagaagtga

DBGET integrated database retrieval system