KEGG   Xiphophorus maculatus (southern platyfish): 102225183Help
Entry
102225183         CDS       T02923                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102225183
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102225183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 616 aa AA seqDB search
MQFSTYLVFLSIFLIALIPTCFSQNDGDLVNTHSGLVQGVRLPVPDGSYVTAFLGIPFGE
PPVGKRRFRPPEPKRKWTGIFEANAYPDACYQYVDTSYPGFQGTEMWNPNRDMSEDCLYL
NIWVPASPRPHNLSVMVWIYGGGFYSGSSSLDVYDGRYLAHTETVIVVSMNYRIGAFGFL
ALHGSSEAPGNVGLLDQRLALKWVQENIHSFGGNPKQVTIFGESAGGASVGFHLLSPDSR
PFFTRAILQSGVPNGPWASVSPAEARRRATLLAKLVNCNGGNDTELVDCLRNKTPQELID
QEWLVLPWSALFRFSFVPVVDGDFLPDTPEAMINSGNFKDTQILLGVNQDEGSYFLLYGA
PGFSKDNESLISKEDFLEGVRLSVPHANDIGLEAVVLQYTDWMDENNGVKNRDAMDDIVG
DHNVICPLAHFARSYAQHHTLKANLGMMNSAGNSQGGVYLYLFDHRASNLAWPEWMGVIH
GYEIEFVFGLPLEKRLNYTTEEKNLSRRMMKYWANFARTGNPNDGLLDTRKRWPLFTANE
QKHVALNTDPLKIHKGLRNQMCAFWNRFLPRLLNITGNIDEAERQWKVEFHRWSSYMMHW
KSQFDHYSKQERCTDL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctccacttatctcgtcttcttgtcaatctttctcatcgctctcatcccaacc
tgcttttcccaaaatgatggagaccttgttaatacacatagcggtctagttcaaggtgtg
cgccttccggtgccggatgggagctatgtcacagctttcctcggcatcccttttggtgag
ccaccagtgggtaagcgtcgcttccgtcctcctgagccaaagcgaaaatggacggggatt
tttgaggctaatgcctaccccgacgcctgttaccagtatgtggacacgtcgtacccaggc
ttccagggcactgagatgtggaatcctaacagagacatgagcgaggactgcctgtacctt
aacatctgggtgcctgcctcgcccaggccccacaatctctcggttatggtgtggatctat
ggtggaggtttctacagtggctcttcttcgctggatgtgtatgatggccgttatcttgct
cacactgagacggtcattgtggtctccatgaattaccgtattggagcctttggtttcctc
gctcttcatggctcttcagaggctccaggaaatgtcggtctgctggaccagaggttggca
ttgaagtgggtgcaagaaaatatccattcctttggtggaaaccccaaacaggtgactatc
ttcggtgagagtgctggcggtgcttcagtcgggttccacctattgtctccagatagcaga
ccttttttcacaagggccatccttcagagcggggtccccaacggtccgtgggcctctgtc
agccctgctgaggccagaagacgtgccacgcttctggcaaagcttgttaactgtaatgga
ggcaacgacactgagctggtggactgtctgcgcaacaaaactccacaggaacttatcgac
caagaatggctggttctaccatggtcagctctgttccggttctcctttgtaccagtcgtg
gatggtgattttctgcctgatactccagaagcaatgattaactcaggcaattttaaagac
actcagattcttcttggtgtcaaccaagatgagggctcttactttctgctgtatggagcg
ccgggattcagcaaggacaatgagagtctaatttccaaagaagacttcctggaaggtgta
cgactgagcgtaccacacgcaaatgatatcggcttggaggcagtggtgctgcagtacacc
gactggatggatgagaataacggagtgaaaaaccgcgacgccatggacgacattgttggc
gatcacaatgtaatttgcccactggcacattttgctcgttcatatgcacagcatcacact
ctcaaggcgaacctgggcatgatgaacagtgcaggaaactcacaaggcggcgtgtacctc
tacctgtttgaccaccgggcttctaatttagcctggccagagtggatgggagtcatccat
ggctatgaaatcgagtttgtctttgggttgccactggagaagagactcaattacaccact
gaagagaagaatctgagtcgacgcatgatgaaatactgggcaaactttgcacggacagga
aatcctaacgacgggctgctggacactcggaaacgctggcctttgtttacggcgaatgag
cagaaacatgtcgcactcaacaccgaccctctcaaaatccacaaaggtttgcgcaaccag
atgtgtgctttctggaaccgcttcctgccacgccttctgaacatcacaggcaacatcgat
gaggcagagcgtcagtggaaggtggagtttcaccgctggtcctcctacatgatgcactgg
aagagtcagtttgatcactacagcaagcaggagcgctgcactgacctctga

DBGET integrated database retrieval system