KEGG   Xiphophorus maculatus (southern platyfish): 102225213Help
Entry
102225213         CDS       T02923                                 

Definition
(RefSeq) glutaminase kidney isoform, mitochondrial-like isoform X1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00220  Arginine biosynthesis
xma00250  Alanine, aspartate and glutamate metabolism
xma00471  D-Glutamine and D-glutamate metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102225213
   00220 Arginine biosynthesis
    102225213
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102225213
Enzymes [BR:xma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102225213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_3 Ank_5 Ank DUF1400
Motif
Other DBs
NCBI-GeneID: 102225213
NCBI-ProteinID: XP_005807428
Ensembl: ENSXMAG00000010380
Position
24
AA seq 617 aa AA seqDB search
MLPFRSTAALKELLQSQLKWPARAAMTVPPAAAAALGFACPLSGWRAPQPGRKAGYRGFC
TPAKGHSEATSDTSGDKRRKAGILPSLEDLLFYTIAEGQEKIPAHKFTTALKSTGLRTGD
PRLKECMEMLKVTLKTTSDGALDRHLFKKCVQSNIVLLTQAFRKKFVVPDFQSFSTHIND
IYDNGKKLSGGQVADYIPQLARFSPDLWGVALCTVDGQRHTVGDTKVPFCLQSCVKPLKY
AIAVHDHGTEYVHRFIGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVCTSLIKQGASNAE
KFDYVMNFMNKLAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMTSILDF
YFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFA
FHVGLPAKSGVAGGILLVVPNVMGIMCWSPPLDKLGNSVRGIQFCTDLVSLCNFHNYDNL
RHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSSMDMEQRDYDSRTALHVA
AAEGHAEVVRFLLEACKVNPVPKDRWGNTPMDEAVHFGHHDVVTILRDYHTQYSPQDAAA
TAAADPQSAEKNLDGLL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgttgccttttcgctcgacggcagctctgaaggagttgctccagagccaactgaagtgg
ccggccagagccgctatgacagttccgcccgcggccgcggctgccctcggcttcgcctgt
ccgctcagcggctggagagccccgcagcccggcaggaaggccggttataggggcttctgc
accccggcgaagggccacagcgaagccaccagtgacacctccggagataagagaaggaag
gcgggcatcctgcccagcctggaggatctgctgttctacaccatcgcagagggacaggag
aagatcccggctcacaagttcaccaccgctctgaaatccacggggcttcggaccggagac
cctcggctcaaagagtgcatggagatgctgaaggtcaccttgaagacgacctcagacgga
gcgctggaccgacacctcttcaagaagtgtgtccagagcaacatcgtcctgctgactcag
gccttcaggaagaagttcgtcgtcccagacttccagtccttctccacccacatcaatgac
atctatgacaacggcaaaaaactgtcaggagggcaggtggcggactacattccccagctg
gctcgcttcagtcccgacctttggggcgtcgcgctgtgcaccgtggacggacaacggcac
acggtgggagacaccaaggtccccttctgtctgcagtcgtgtgtgaagccgctgaagtac
gccatcgccgtccacgaccacggcaccgagtacgtgcaccgcttcatcggcaaggagccc
agcgggctgaggttcaacaagctgttcctgaacgaggacgataaaccccacaaccccatg
gtgaacgccggcgccatcgtctgcacctccctcatcaagcaaggagccagcaacgccgag
aagttcgactacgtgatgaacttcatgaacaagctggcaggaaacgagtacgttggcttc
agcaacgccactttccagtcggagcgcgagtccggagacaggaacttcgccatcggctac
tacctgaaggagaagaagtgtttccctgaaggaaccgacatgacctccatcctggacttc
tacttccagctctgctccatcgaggtgacctgcgagagcgccagcgtcatggccgccacg
ctcgccaacggcggcttctgtccgatcacgggcgagcgcgtgctgagccccgaggcggtc
cgcaacacgctgagcctcatgcactcctgcggcatgtacgacttctccggccagttcgcc
ttccacgtggggctgccggcgaaatctggcgtagccggcgggattctgctggtggttccc
aacgtgatgggcatcatgtgctggtctcctccactggacaaactgggaaacagcgtgaga
gggatccagttctgcacggacctggtttctctctgcaactttcacaactacgacaacctg
aggcacttcgccaagaagctggacccccgcagggagggaggagaccagagggtgaagtcg
gtgatcaacctgctgttcgccgcctacaccggagacgtgtcggccctgcgccgcttcgct
ctgtcctccatggacatggagcagagggactacgactcccggacggcgctgcatgtggcg
gcggctgaaggtcacgctgaggtggtccgcttcctgctggaggcctgtaaggtcaaccca
gtccccaaagacaggtggggcaacacgccgatggacgaggcggtgcacttcggccatcac
gacgtggtcaccatcctcagagactaccacacccagtacagccctcaggatgccgctgcc
accgccgccgccgacccacagagcgccgagaagaacctggacggcctgctgtga

DBGET integrated database retrieval system