KEGG   Xiphophorus maculatus (southern platyfish): 102225592Help
Entry
102225592         CDS       T02923                                 

Gene name
kat5
Definition
(RefSeq) K(lysine) acetyltransferase 5
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102225592 (kat5)
Chromosome [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102225592 (kat5)
   HAT complexes
    TIP60 complex
     102225592 (kat5)
    NuA4 complex
     102225592 (kat5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 516 aa AA seqDB search
MTKMADNSSSVEIVEGCRLPVLRKNQEHEDEWPLAEILSVKEASGRKLYYVHYIDFNKRL
DEWVTTDRLDMKKLQFPKKEAKTPTKNGLSGSRPSSPEREVVSERRETDTDPALQKKQRK
SLDLNIPSATPPSRGKTLPTPKRKVESVPLVTQVPPVTPVPSLPSSAEASQAAVFPAVRE
ATTFKSREDHEPLSTLTTNGTARRLIPAQPGRKRKANCGVPDEMIKVLQYNKPQSATVFL
PPPEDSQDSSDGIPTAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQE
LTTLPILYLCEFCLKYLKSLKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKNYS
QNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDSKGFHIVGYFSKEKESTEDYNVACILTL
PPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKPEN
GERPQITINEISEITSVKKEDVISTLQYLNLINYYK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaatggcggacaactcgtcttcggtggagattgtggaaggctgtcgcctcccc
gtacttcgtaaaaaccaagaacatgaagacgaatggccattggctgagattctaagtgtg
aaggaagcttctgggagaaagctctactatgtccactacattgactttaataagcgcctc
gatgaatgggtgacaacggacaggctggacatgaagaagcttcagtttccaaagaaagaa
gctaaaacacccacaaagaacggtctgtcaggctcccgtcccagttcaccagagagagag
gtggtgagtgaaagaagagaaacagatactgaccccgctttacagaagaaacagaggaag
agtctagatctcaacataccatctgccacacccccatccagaggcaaaacgctccccaca
ccgaagaggaaagtagagagcgttcccctggtgacgcaggttccccctgtgacccctgtg
ccctctctaccaagttcagccgaagcttctcaggcggctgtttttcctgctgtcagagaa
gccaccaccttcaagtccagagaggatcacgaaccgctctccacgctcacaacgaatggc
accgcccggcgcctcatacctgctcagcctggaagaaaaaggaaagctaactgtggggtc
ccagatgagatgataaaggttttgcagtataacaagcctcaaagtgccactgtgtttcta
ccgccaccagaggattctcaggacagctcagacggcatcccgaccgccccgcggatgacc
ggcagtctggtgtcggaccggagccacgatgacatcgtcacacggatgaaaaacatcgag
tgcatagagctgggccgacacagactgaagccctggtacttctcaccgtacccacaggaa
ctcaccacgttgcccatcctctacctctgtgaattctgtctgaaatacctcaaaagcctc
aagtgtcttcagaggcatttgactaaatgtaatttaagacatcctcctggcaatgagatc
taccgcaagggcaccatctctttctttgagattgacggcaggaaaaacaaaaattactcc
caaaacttgtgtttactggcaaagtgtttcctggaccacaaaacattgtattatgacaca
gaccctttcctcttctatgtaatgacggagtatgactccaagggcttccatatagtcggc
tacttctctaaggaaaaagagtcaacagaagattataacgttgcctgcatcctgacgttg
ccgccctaccagcgcagaggttacgggaagctgctcatcgagttcagttacgagttgtca
aaggtggaggggaagacgggaactccggagaagccgctgtctgatctcggcctcttgtcg
tatcgttcctattggtcccaaacaatcctagaaattctcatggaccttaaacctgaaaac
ggagaacgaccccagataaccataaatgagatcagtgaaatcactagtgtaaagaaggaa
gatgtcatttcaacgctccagtaccttaacctaatcaactattacaag

DBGET integrated database retrieval system