KEGG   Xiphophorus maculatus (southern platyfish): 102225809Help
Entry
102225809         CDS       T02923                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102225809
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102225809
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102225809
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102225809
  Exosomal proteins of breast milk
   102225809
Heparan sulfate/heparin binding proteins [BR:xma00536]
 Enzymes (General comment) Variety
  102225809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 507 aa AA seqDB search
MRAWQLWFLCFVVLNADAQKVTSLEEDLADAAFGNFLDPLKDLFDEDEHHSAIAKFSLRN
PSHPDDDLCYIVPGKPETLAACAFNSSSKTFLVIHGWTLSGMFESWMPKLVSALYERERT
ANVVVVDWLSSAQNHYVVAVQKTKAVGREIARFIDWIEETTNLPLDKLHLIGYSLGAHVA
GFAGNHASNKVGRITGLDPAGPDFEGEHAHRRLSPDDAHFVDVLHTYTRGSLGLSIGIQQ
PIGHVDIYPNGGSFQPGCNMRGALEKIANFGIFAINDAVKCEHERSIHLFIDSLLNEQEP
AKAYQCGSNDVFDRGMCLSCRKGRCNTVGYSTSQIRRPHSIQMYTKTRASMPFRVYHYQL
KIHFSSKVNMSEMEPSLTASLYGTKGEAENLELKLKERLETNRTHSFLLVTETDIGDLLM
LKFKWTETNSWSVSNLLKMVSSWWSGNADGVEVHKIRIKSGETQQKMVFCLKDPDAHSAH
LVTFVKCKDEWRMKRKPISKRVTLKND
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctggcaactttggtttctgtgcttcgtggtgttgaatgcggatgcgcaaaaa
gtgacttccctggaagaagatctcgctgatgctgcgtttggcaacttccttgaccctctg
aaagatttgtttgacgaggatgaacatcactcggctatcgcaaaattctccctgcgtaat
ccgtcccatcccgacgacgacctctgctacattgttcccggaaaaccagagaccctggcg
gcctgcgccttcaacagctcatccaaaaccttcctggtgatccacggatggacgctgagc
ggtatgtttgaaagctggatgccgaagttggtgtctgcgctgtacgagagagagcggacg
gccaacgttgttgtggtggactggctgagctcggctcagaaccactatgtggtcgcagtt
cagaaaaccaaagcagtgggaagagagattgcacgcttcattgactggatcgaggaaacc
accaacctgcctcttgacaagctgcacctgatcggctacagcctgggggcgcatgtggct
ggatttgctggcaaccatgccagcaacaaagttggacggattactggtctggatccagct
ggacctgactttgagggcgaacacgcccacaggcgcctctctccagatgacgcccacttc
gtggacgtcctccacacctacactcggggttctctgggtctcagcatcgggatacagcaa
cccatcggccatgtggacatctaccccaacgggggcagcttccagccgggctgcaacatg
aggggcgccttggagaaaatcgctaactttgggatatttgccatcaatgatgcggtgaag
tgcgaacatgaacgctccatccatcttttcatcgactccctgctgaacgagcaggaacct
gccaaggcctaccagtgcggcagcaacgacgtgttcgaccgcggcatgtgtctgagctgt
cgcaagggccgctgcaacactgtcggctacagcacaagccaaatccgcaggccacacagc
attcagatgtacaccaagacacgagcttccatgcctttcagagtttaccattaccagctg
aagatccacttctccagtaaagtgaacatgtcagagatggagccgtctctcaccgcctct
ctgtatggaaccaaaggagaggctgaaaacctggagcttaagctgaaggaaagacttgag
acaaacaggacacattcgtttcttctggtcactgaaacggatatcggcgacctgctgatg
ttgaagtttaagtggacggagacaaacagctggtcggtgtccaacctcttaaagatggtt
tcctcttggtggtctgggaacgcagacggtgtggaggttcacaaaatccgtatcaaaagt
ggcgagacgcaacaaaagatggttttctgtttgaaagaccccgatgcccacagcgcacat
ttggtcacatttgttaaatgtaaagatgaatggagaatgaaacgtaaaccaatttcaaag
agagtaactctgaagaatgactga

DBGET integrated database retrieval system