KEGG   Xiphophorus maculatus (southern platyfish): 102226073Help
Entry
102226073         CDS       T02923                                 

Gene name
bap1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase BAP1
  KO
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102226073 (bap1)
Peptidases [BR:xma01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102226073 (bap1)
Ubiquitin system [BR:xma04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102226073 (bap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
20
AA seq 727 aa AA seqDB search
MNNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCHSPVYGFIFLFKWIEERRSR
RKVNTLVDETSVIDEEIVNDMFFAHQLIPNSCATHALLSVLLNCSGVELGTTLSRIKAFT
KGFSPESKGYAIGNAPELARAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDR
LFELDGLKAYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRM
KYESKLEILKRNRQIILEGLQKMIRLTQPEVVHDKKQQNTSSPDENTIKKEADADSVDES
GVQSKDGAGPSGSSKVMGKPAAPTGGGAQQVNPIVQRLPAFLDNHNYAKSPMQEEEDLAA
GVGRARTAGPPQPPFSDDEDEFDEDEEEAAGSASASSRFRRKASLRSRKGRVGTGMESQI
ALNVLAEKLKKEAQRKDGVNTPLSVRTEGRTGGICITSASQPSPTPSNESTDTASEIGSA
FNSPLRSPARSQAATRPSSPVASHLSRVLFGEDEMLRLDSRHNRAVRELGPSVSASLLHL
QDDGVIYALPPSGDSAEGTKLCTLEKVKLKVKEDEKDPIKEGDEGPSVAVKKEDENEDGA
ELKPGKEKLNVTESGADSKPPGDKYSPKELLALLKCVEADIANYEVFLKEEVEKRKKFKI
DDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSR
PYKAKRQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaaggctggctggagttggagagtgatccagggctgtttactttgctggtg
gaagattttggtgtcaaaggcgtccaagttgaggaaatctatgatctacaaagtaaatgt
cacagtcctgtttatggcttcatcttcctttttaagtggattgaagagcgtcggtccagg
agaaaagtcaacaccttggtggatgagacctcagttatagatgaggaaattgtaaatgac
atgttctttgctcatcagctgataccaaactcatgtgccactcatgctttgctgagtgtt
ctcctgaactgcagtggagtcgaactcggcactaccctcagtcgcataaaggcttttact
aaaggcttcagtcctgagagcaaaggctatgcgataggaaatgctccagagctcgccagg
gcacacaacagccacgccagaccggaacccaggcaccttccggagaaacagaacgggatc
agtgcggtgcggacgatggaggccttccactttgtcagctatgtgccaatcaaagaccgc
ctctttgagcttgatgggctcaaggcttaccccattgatcatgggccctggggagaggat
gaggaatggaccgacaaggctcgccgtgttattatggagaggattggcctggccactgct
ggtgagccgtaccatgatatccgcttcaacctgatggcagtggtgcctgaccgcagaatg
aagtatgagtccaagctggaaattctaaagaggaaccgacagatcattctggagggtctg
cagaagatgatccggctcactcagcctgaggttgtccacgacaagaagcagcagaacact
tcgtctccagatgaaaacaccatcaagaaagaagcagatgcagattcagtggacgagtcg
ggggttcagtccaaggatggagctggcccctctggaagctcaaaggtcatgggaaaaccc
gctgcccccacaggaggaggagcccagcaagtcaaccccatcgttcagcgcctgcctgcc
ttcctcgacaaccacaactacgccaagtccccgatgcaggaggaggaagatctagcagct
ggtgttggacgcgctcggacagctggccctcctcagcctccgttctcagatgatgaagac
gaatttgatgaagacgaggaagaagcagcaggttctgccagtgcttccagcagattcaga
cgaaaggcgagcctgcggtccagaaagggacgggttggaactgggatggagagccagatt
gccctcaatgttttggcagagaaactgaagaaggaagctcaaagaaaagatggtgtaaac
accccgctgtctgtgcgcactgaaggtcgcaccggggggatctgcatcacgtccgcctcg
cagccttcccccacacccagcaacgaaagcacagatacggcctctgaaattggcagcgcc
ttcaactccccactgcgctcgccggctcgctctcaggcggccacgcgtccctcgagccca
gtcgcttcccatctgtcccgtgtgctgttcggagaggatgaaatgttgaggctggactcc
agacataaccgcgccgtaagagaactgggaccttcagtcagtgcatcgctgttgcactta
caagacgacggagtcatttatgctctccctccatctggagattctgctgaaggcacgaag
ctctgcacccttgagaaggtaaaactcaaagtgaaggaagatgaaaaagaccccataaaa
gaaggagatgagggaccatctgtagcggtgaagaaagaagacgagaacgaagatggtgcg
gagttgaaacctggcaaggaaaagctcaatgttacagagtctggagcagacagcaagcca
ccaggggataagtactctccaaaagagctgcttgcactactcaagtgtgtagaagctgac
attgccaattatgaggtgtttctaaaggaggaagtagaaaagagaaagaaattcaaaata
gatgatcagaggaggactcacaattacgacgagtttatctgcacatttatatcaatgttg
gcccaagaaggcatgctggccagcctcgtggagcaaaacatctctgtgcgccgccggcag
ggagtgagcatcggccggctgcacaagcagaggaagcctgatcgaaggaaacgctcccga
ccttacaaagccaaacgccagtaa

DBGET integrated database retrieval system