KEGG   Xiphophorus maculatus (southern platyfish): 102226073Help
Entry
102226073         CDS       T02923                                 

Definition
ubiquitin carboxyl-terminal hydrolase BAP1-like
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102226073
Peptidases [BR:xma01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102226073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 733 aa AA seqDB search
MNNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCHSPVYGFIFLFKWIEERRSR
RKVNTLVDETSVIDEEIVNDMFFAHQLIPNSCATHALLSVLLNCSGVELGTTLSRIKAFT
KGFSPESKGYAIGNAPELARAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDR
LFELDGLKAYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRM
KYESKLEILKRNRQIILEGLQKMIRLTQPEVVHDKKQQNTSSPDENTIKKEKRETQSVLI
LDSVDESGVQSKDGAGPSGSSKVMGKPAAPTGGGAQQVNPIVQRLPAFLDNHNYAKSPMQ
EEEDLAAGVGRARTAGPPQPPFSDDEDEFDEDEEEAAGSASASSRFRRKASLRSRKGRVG
TGMESQIALNVLAEKLKKEAQRKDGVNTPLSVRTEGRTGGICITSASQPSPTPSNESTDT
ASEIGSAFNSPLRSPARSQAATRPSSPVASHLSRVLFGEDEMLRLDSRHNRAVRELGPSV
SASLLHLQDDGVIYALPPSDSAEGTKLCTLEKVKLKVKEDEKDPIKEGDEGPSVAVKKED
ENEDGAELKPGKEKLNVTESGADSKPPGDKYSPKELLALLKCVEADIANYEVFLKEEVEK
RKKFKIDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPD
RRKRSRPYKAKRQ
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaaggctggctggagttggagagtgatccagggctgtttactttgctggtg
gaagattttggtgtcaaaggcgtccaagttgaggaaatctatgatctacaaagtaaatgt
cacagtcctgtttatggcttcatcttcctttttaagtggattgaagagcgtcggtccagg
agaaaagtcaacaccttggtggatgagacctcagttatagatgaggaaattgtaaatgac
atgttctttgctcatcagctgataccaaactcatgtgccactcatgctttgctgagtgtt
ctcctgaactgcagtggagtcgaactcggcactaccctcagtcgcataaaggcttttact
aaaggcttcagtcctgagagcaaaggctatgcgataggaaatgctccagagctcgccagg
gcacacaacagccacgccagaccggaacccaggcaccttccggagaaacagaacgggatc
agtgcggtgcggacgatggaggccttccactttgtcagctatgtgccaatcaaagaccgc
ctctttgagcttgatgggctcaaggcttaccccattgatcatgggccctggggagaggat
gaggaatggaccgacaaggctcgccgtgttattatggagaggattggcctggccactgct
ggtgagccgtaccatgatatccgcttcaacctgatggcagtggtgcctgaccgcagaatg
aagtatgagtccaagctggaaattctaaagaggaaccgacagatcattctggagggtctg
cagaagatgatccggctcactcagcctgaggttgtccacgacaagaagcagcagaacact
tcgtctccagatgaaaacaccatcaagaaagaaaaacgtgaaactcaatcagttctaatt
ctagattcagtggacgagtcgggggttcagtccaaggatggagctggcccctctggaagc
tcaaaggtcatgggaaaacccgctgcccccacaggaggaggagcccagcaagtcaacccc
atcgttcagcgcctgcctgccttcctcgacaaccacaactacgccaagtccccgatgcag
gaggaggaagatctagcagctggtgttggacgcgctcggacagctggccctcctcagcct
ccgttctcagatgatgaagacgaatttgatgaagacgaggaagaagcagcaggttctgcc
agtgcttccagcagattcagacgaaaggcgagcctgcggtccagaaagggacgggttgga
actgggatggagagccagattgccctcaatgttttggcagagaaactgaagaaggaagct
caaagaaaagatggtgtaaacaccccgctgtctgtgcgcactgaaggtcgcaccgggggg
atctgcatcacgtccgcctcgcagccttcccccacacccagcaacgaaagcacagatacg
gcctctgaaattggcagcgccttcaactccccactgcgctcgccggctcgctctcaggcg
gccacgcgtccctcgagcccagtcgcttcccatctgtcccgtgtgctgttcggagaggat
gaaatgttgaggctggactccagacataaccgcgccgtaagagaactgggaccttcagtc
agtgcatcgctgttgcacttacaagacgacggagtcatttatgctctccctccatctgat
tctgctgaaggcacgaagctctgcacccttgagaaggtaaaactcaaagtgaaggaagat
gaaaaagaccccataaaagaaggagatgagggaccatctgtagcggtgaagaaagaagac
gagaacgaagatggtgcggagttgaaacctggcaaggaaaagctcaatgttacagagtct
ggagcagacagcaagccaccaggggataagtactctccaaaagagctgcttgcactactc
aagtgtgtagaagctgacattgccaattatgaggtgtttctaaaggaggaagtagaaaag
agaaagaaattcaaaatagatgatcagaggaggactcacaattacgacgagtttatctgc
acatttatatcaatgttggcccaagaaggcatgctggccagcctcgtggagcaaaacatc
tctgtgcgccgccggcagggagtgagcatcggccggctgcacaagcagaggaagcctgat
cgaaggaaacgctcccgaccttacaaagccaaacgccagtaa

DBGET integrated database retrieval system