KEGG   Xiphophorus maculatus (southern platyfish): 102226157Help
Entry
102226157         CDS       T02923                                 

Definition
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Inositol phosphate metabolism
ErbB signaling pathway
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Focal adhesion
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102226157
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    102226157
   04370 VEGF signaling pathway
    102226157
   04630 Jak-STAT signaling pathway
    102226157
   04068 FoxO signaling pathway
    102226157
   04070 Phosphatidylinositol signaling system
    102226157
   04150 mTOR signaling pathway
    102226157
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102226157
  Cell growth and death
   04210 Apoptosis
    102226157
  Cell communication
   04510 Focal adhesion
    102226157
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    102226157
  Endocrine system
   04910 Insulin signaling pathway
    102226157
   04914 Progesterone-mediated oocyte maturation
    102226157
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102226157
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102226157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1074 aa AA seqDB search
MPPRPSSGELWGIHLMPPRILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRNASGPHSRALYVYPPSVESTQELPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYIRSCIMLTRMPNLMLMAKDSLYTQLPTD
NFVMPSYSRRISTATSYMNGEASSKSLWSINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLPYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVANKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHF
SCPVKYPDMNAVEDHANWIISRELGFNFNLSVNHSGTQQSSRVARDHALTESDSEQMRQL
SNRDPLSEITEQEKDFLWRHRHYCMNIPEILPKILLAVKWNSRDDVAQMYCLLKEWPSIR
PEQAMELLDCNYPDPMVRHFAVRCLDKYLTDDKLSQYLIQLVQVLKYEQYLDSPLARFLL
KKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLIN
LTDILKQEKKDETQKVQMKFLVDQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRIMSS
AKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRML
PYGCLSLGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNKGETYDMAV
DLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPF
VLTQDFLIVISKGSQECTKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQ
SFDDIAYIRKTLALEKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaggccgtcctcaggggagctatggggcatccacctgatgcccccaaggatc
ctagtggactgcctgctgcccaatgggatgattctgaccttggagtgtctccgagaggcc
acgctaatcaccatcaagcatgagttgttcaaggaggccagaaaatatcccctccatcac
ctcctgcaggaggaaacctcctacatttttgtcagtgttacacaggaagctgagcgggag
gagttctacgatgagactcgaaggctgtgtgaccttcgactcttccagcctttcctcaaa
gtgattgagccagtcggcaacagagaggaaaagatcctgaacagagagatcggttttgcc
attggcatgcctgtgtgtgagttcgacctggtgaaggacccagaggtccaggacttcagg
agaaacatcctgaatgtttgtaaagactctgtggagctgagaaacgccagcggtccccac
agcagagcgctgtacgtttacccccccagcgtcgagtcgacacaggaacttcccaaacac
atctatagcaaactggacaaaggtcagattattgttgtaatatgggtgatcgtttcccca
aacaatgacaagcaaaagtatacactaaagatcaaccatgactgtgtgccggaacaggtg
attgcagaggccattcgcaagaagacgcgcagcatgctgttgtccccagagcagttgaag
atgtgtgttcaagaatatcagggcaaatacatcctcaaagtttgtggctgtgacgaatac
ctgctggaaaagtatcctataagccagtacaagtacatccgtagttgcatcatgttgacc
aggatgccaaacctgatgctaatggctaaggacagcctgtacactcagctgcctactgat
aacttcgtcatgccatcatactctcgacgtatctccacggcaacgtcgtacatgaatgga
gaggcttcgtccaagtcgctgtggagcatcaatgggactctgcgaatacgaatcctctgc
gccacctacgtcaacgtgaacatacgggacatagacaagatttatgtgaggactggaatt
taccacggaggtgaacaaatgtgtgacaacgtcaacacacagagagtaccctgctctaat
cccaggtggaatgagtggctcccgtatgacatgtacatcccggacatcccccgagctgcc
aggctctgcctctccatctgctctgttaaaggcagaaagggagccaaggaggaacactgt
ccactagcttggggcaacattaacctatttgactacactcacactctggtggccaacaag
atggctctgaacctctggccagtccctcatggccttgaagacctcctcaacccaatagga
gtcactggatctaatcccaataaggaaacgccatgtctggagctggagtttgaccacttc
agctgtcctgtcaaatacccagacatgaatgcagtggaagatcatgcaaactggatcatc
tccagggaactggggtttaacttcaatctctcagtcaaccactcgggaactcaacagagc
agtcgggtggccagagatcacgccctgacggaaagcgacagcgaacagatgcgacagctg
agtaacagggaccctctgtctgaaatcactgagcaggagaaagacttcctctggagacac
aggcattactgtatgaacatcccagagatccttcccaagatacttcttgctgtcaaatgg
aactccagagatgatgtagcgcagatgtattgtttgttgaaggaatggccatcgatccgt
ccagaacaggccatggagctgctggactgtaattacccagaccccatggtcagacacttc
gctgtacgctgccttgacaaatacttgaccgacgataaactctcccagtaccttatccag
cttgttcaggtattaaaatacgagcagtatcttgacagtccgctagctcgctttctcctc
aaaaaggccctgaccaatcaaaggataggccatttcttcttctggcatctcaagtcagaa
atgcacaacaaaactgtgagccagaggtttgggctgctgctggaggcttactgcagggct
tgtggcatgtacctcaaacacctgagcaggcaggtggaagccatggagaagcttatcaac
ctcaccgacatactcaaacaggaaaagaaggatgagacacaaaaggtccagatgaagttt
cttgtagaccagatgaagagacccgactacatggacgctctgcagagcttcacctctcca
ctcaaccctgcacatcagctgggaaatctgaggttggaggagtgcaggatcatgtcatcc
gcaaagagaccgctgtggctcaactgggagaatcctgacatcatgtccgagttactgttt
cagaataatgagatcatcttcaaaaacggagatgatttgcggcaggatatgctgacgctg
cagataatcagaatcatggagaacatttggcagaaccagggactggacctacggatgctc
ccctacggctgtctgtctctgggagactgcgtgggcctgatagaggtggttcgaaactcc
cacaccatcatgcagattcagtgcaaaggaggcttgaaaggagccttgcagttcaactcc
aacacgctgcatcagtggctcaaggacaaaaacaaaggagagacgtatgacatggctgtg
gatctgtttacgaggtcctgcgctggctactgtgtagccacgtttattctggggatcgga
gaccggcacaacagcaacattatggtcaaagatgacggacagttgtttcatatagatttt
ggccatttcttggatcacaagaagaagaaatttggctacaagagagagcgagtcccgttc
gtactgactcaagacttcctcatcgtcatcagtaagggatcccaggagtgcacaaagacc
aaagagtttgaaaggttccaggaaatgtgctacaaagcgtacctggccatccgccagcac
gccaacctcttcatcaacctgttctccatgatgctgggctccggcatgcccgagctgcag
tcgttcgacgacatcgcctacatccggaagacgctggcgctggagaaaaccgagcaggag
gctttggattatttcatgaagcagatgaacgacgcccaccatggaggttggaccaccaag
atggactggattttccacacgattcggcagcatgcactaaactaa

DBGET integrated database retrieval system