KEGG   Xiphophorus maculatus (southern platyfish): 102226170Help
Entry
102226170         CDS       T02923                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    102226170
   01210 2-Oxocarboxylic acid metabolism
    102226170
   01230 Biosynthesis of amino acids
    102226170
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102226170
Enzymes [BR:xma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102226170
Amino acid related enzymes [BR:xma01007]
 Aminotransferase (transaminase)
  Class I
   102226170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 491 aa AA seqDB search
MSQQAVNGVSCRGKVLTVENMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIK
ANIGDAQAMGQRPITFFRQVLVLCSYPELLEDNKFPEDAKKRARRILDACGGHSIGAYSA
SQGIECIRQDVARYIERRDGGIPSNPDNIYLSTGASDAIVTILKLLVCGEGRDRTGVMIS
IPQYPLYSAALADLAAVQINYYLDEDNCWSLNVAELKRALNEAKQHCKPRVLCIINPGNP
TGQVQSRQCIEDVIQFAKEEHLFLMADEVYQDNVYAEGCKFHSFKKVLFEMGPEYSSTVE
MASFHSTSKCYMGECGFRGGYMEVINMDPEVKAQLTKLVSVRLCPPVPGQALLDLVVNPP
QPDEPSYTLFTKERTAVLATLAEKARLTEEIFNEVPGITCNPVQGAMYTFPRITLPQKAI
DKAKAEGKVPDMFYCMKLLEEEGICLVPGSGFGQKDGTFHFRMTILPPTEKLKVVLQKIR
DFHLRFTNEFS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcaggcagtgaacggggtgtcgtgtcgggggaaggtgctgaccgtggagaac
atgaaccccaacgtgaagcgggtggagtacgcggtccgcggccccatcgtccagcgggcg
gtgcagatagagaaggagctccgagagggtgtgaagaaacctttcacagaagtcatcaag
gcgaacataggcgatgcccaagctatgggtcagagaccaatcacatttttcagacaggtg
ttggttctttgttcttacccggagcttttggaagacaacaagtttccagaggacgccaag
aagagagctcggcgtattctcgacgcctgcgggggtcacagtataggggcctacagcgcc
agccagggaatcgagtgcattcggcaggatgtggcacgttacatcgagaggagagacggc
ggcatcccctccaatcccgacaacatctacctctccaccggggccagcgatgctattgtg
accattctgaagctgctggtgtgcggcgagggtcgagaccgcaccggggtgatgatctca
atccctcagtaccctctgtactcggccgccctggcggacctggccgctgtgcagatcaac
tactatctggacgaggacaactgttggagtctgaacgtggcagagctcaagagagcgcta
aatgaagccaagcagcactgcaagccccgcgtgctctgcatcatcaaccccgggaacccc
acaggtcaagtgcagagcagacagtgtattgaggatgtgatccaattcgctaaagaggaa
catctcttcctcatggccgatgaggtctaccaggataacgtgtacgctgagggctgcaag
tttcactccttcaaaaaggttctgtttgagatgggaccggagtattccagcaccgtggag
atggcctccttccactccacctctaagtgctacatgggagagtgtgggttccgtggcggc
tacatggaggtgatcaacatggacccggaggtgaaggcccagctcaccaaactggtgtcg
gtgcgtctgtgcccccccgttccgggacaggccctcctggacctggtggtgaacccccca
cagcccgatgaaccgtcctacactttgtttacgaaggagcggacagcagtgctggccacg
ctggcagagaaggccaggctgacggaggagatcttcaacgaagtaccagggatcacctgc
aatccggtgcagggtgccatgtacaccttcccccgcatcactctcccacagaaagccatc
gacaaggccaaggcggaaggcaaagtcccggacatgttttactgtatgaagctgctggag
gaggagggaatctgcttggtgccaggaagtggcttcggtcagaaagatggaaccttccac
ttcaggatgaccatcttacctcctaccgagaagctgaaggtggtgctgcagaagatccgt
gacttccacttgcgatttaccaacgagttttcctaa

DBGET integrated database retrieval system