KEGG   Xiphophorus maculatus (southern platyfish): 102226170Help
Entry
102226170         CDS       T02923                                 

Definition
alanine aminotransferase 2-like
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:xma01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:xma01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:xma01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:xma00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 491 aa AA seqDB search
MSQQAVNGVSCRGKVLTVENMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIK
ANIGDAQAMGQRPITFFRQVLVLCSYPELLEDNKFPEDAKKRARRILDACGGHSIGAYSA
SQGIECIRQDVARYIERRDGGIPSNPDNIYLSTGASDAIVTILKLLVCGEGRDRTGVMIS
IPQYPLYSAALADLAAVQINYYLDEDNCWSLNVAELKRALNEAKQHCKPRVLCIINPGNP
TGQVQSRQCIEDVIQFAKEEHLFLMADEVYQDNVYAEGCKFHSFKKVLFEMGPEYSSTVE
MASFHSTSKCYMGECGFRGGYMEVINMDPEVKAQLTKLVSVRLCPPVPGQALLDLVVNPP
QPDEPSYTLFTKERTAVLATLAEKARLTEEIFNEVPGITCNPVQGAMYTFPRITLPQKAI
DKAKAEGKVPDMFYCMKLLEEEGICLVPGSGFGQKDGTFHFRMTILPPTEKLKVVLQKIR
DFHLRFTNEFS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagcaggcagtgaacggggtgtcgtgtcgggggaaggtgctgaccgtggagaac
atgaaccccaacgtgaagcgggtggagtacgcggtccgcggccccatcgtccagcgggcg
gtgcagatagagaaggagctccgagagggtgtgaagaaacctttcacagaagtcatcaag
gcgaacataggcgatgcccaagctatgggtcagagaccaatcacatttttcagacaggtg
ttggttctttgttcttacccggagcttttggaagacaacaagtttccagaggacgccaag
aagagagctcggcgtattctcgacgcctgcgggggtcacagtataggggcctacagcgcc
agccagggaatcgagtgcattcggcaggatgtggcacgttacatcgagaggagagacggc
ggcatcccctccaatcccgacaacatctacctctccaccggggccagcgatgctattgtg
accattctgaagctgctggtgtgcggcgagggtcgagaccgcaccggggtgatgatctca
atccctcagtaccctctgtactcggccgccctggcggacctggccgctgtgcagatcaac
tactatctggacgaggacaactgttggagtctgaacgtggcagagctcaagagagcgcta
aatgaagccaagcagcactgcaagccccgcgtgctctgcatcatcaaccccgggaacccc
acaggtcaagtgcagagcagacagtgtattgaggatgtgatccaattcgctaaagaggaa
catctcttcctcatggccgatgaggtctaccaggataacgtgtacgctgagggctgcaag
tttcactccttcaaaaaggttctgtttgagatgggaccggagtattccagcaccgtggag
atggcctccttccactccacctctaagtgctacatgggagagtgtgggttccgtggcggc
tacatggaggtgatcaacatggacccggaggtgaaggcccagctcaccaaactggtgtcg
gtgcgtctgtgcccccccgttccgggacaggccctcctggacctggtggtgaacccccca
cagcccgatgaaccgtcctacactttgtttacgaaggagcggacagcagtgctggccacg
ctggcagagaaggccaggctgacggaggagatcttcaacgaagtaccagggatcacctgc
aatccggtgcagggtgccatgtacaccttcccccgcatcactctcccacagaaagccatc
gacaaggccaaggcggaaggcaaagtcccggacatgttttactgtatgaagctgctggag
gaggagggaatctgcttggtgccaggaagtggcttcggtcagaaagatggaaccttccac
ttcaggatgaccatcttacctcctaccgagaagctgaaggtggtgctgcagaagatccgt
gacttccacttgcgatttaccaacgagttttcctaa

DBGET integrated database retrieval system