KEGG   Xiphophorus maculatus (southern platyfish): 102228206Help
Entry
102228206         CDS       T02923                                 

Definition
amine oxidase [flavin-containing]-like
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:xma00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:xma00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:xma00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xma00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:xma00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:xma00380]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:xma00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 338 aa AA seqDB search
MFYPAAASEHTLSDCRSLGRLVKERKFAGGSSQISECMAKELGDRVKLQSPVYRIDQTGD
MVVVETVNKETYTARYVVVATPPALNLKMHFNPELPPLRNQLIYRVPMGCVIKCMVYYKE
NFWRKKGYCGTMVIEEEGAPIGLTLDDTKPDGTVPAIMGFILARKCRKLADLTKEERLRR
ICEIYSRVLGSEEALHPVHYEEKNWCEEEYSGGCYTAYFPPGTLTQFGRVLREPVGRLYF
AGTETASEWSGYMEGAVQAGERAAREVLCAMGKIHQSQIHQPEPESQEVPALPFVTSFWE
RNLPSVGGFLKLTGVSAVLSAAAAVGLVAYKKGLFPRS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgttttatccggccgccgcgtcagaacacacactctctgactgtcgctctctcggtcgt
ctggtgaaggagaggaagtttgcgggcggctccagccagatcagcgagtgcatggccaag
gagctgggtgacagggtgaagctgcagtcgcccgtctacaggatcgaccagaccggagac
atggtcgtcgtggagacggtgaacaaagagacttacacggccagatacgtcgtcgtggca
acgccgcccgccctcaacctgaagatgcactttaaccccgagctgccgcccctcaggaac
cagctgatctaccgcgtgcccatgggctgcgtcatcaaatgcatggtctactacaaggag
aacttctggaggaagaagggttactgcggcaccatggtgatcgaggaggagggggctcct
ataggcctgactctggatgacacaaagcctgatgggaccgtgcccgctatcatggggttc
attctggctcgcaagtgcaggaagctggcagacctgaccaaagaggagaggctcaggagg
atctgtgagatttactccagagtgctgggctcagaggaggctctccacccggtgcactat
gaagagaagaactggtgtgaggaggaatactccggcggctgctacacagcttactttcct
cctggaaccctgacccagtttggcagggttctgagggagcctgttggcaggttgtacttc
gccggcacggagacggcgtcagagtggagtggctacatggagggggcggtgcaggccggg
gagagggccgccagagaggtcttgtgtgcgatgggtaaaatccaccagagtcaaatccac
cagccagagcctgagagtcaggaagttcctgccctgccgtttgtcaccagcttctgggag
aggaatctgccgtcggtcggcggttttctcaagctcacgggcgtctccgccgtcctgtcc
gccgccgccgcagtgggcctggtggcctacaaaaagggcctgttccccaggagttaa

DBGET integrated database retrieval system