KEGG   Xiphophorus maculatus (southern platyfish): 102228239Help
Entry
102228239         CDS       T02923                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102228239
Transfer RNA biogenesis [BR:xma03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102228239
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 250 aa AA seqDB search
EFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYTPSALVDLVARILALVPPWTRV
YRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQVEL
VRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPELKGGVSIVRELHVYGSVV
PVSSRDPSKFQHQGFGMMLMEEAERIARGEHGSHKLAVISGVGTRNYYRKMGYELEGPYM
VKQLYGARLD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gagttttttgagaatccggcgttcaggcccgatggtctgaagctctacccgacgctggtg
atccggggcacgggtctgtacgagctgtggaagacgggccgctacaagagctacacgccc
agcgccctggtggacctggtggcccgcattctggccctggtgccgccctggacacgggtg
taccgcgtccagagggacatccccatgccactggtgagctccggcgtggagcacggcaac
ctgagggagctggctctggctcggatgaaggacatgggcactgagtgccgagacgtacgg
acccgagaagttggcattcaggaaatccaccacaaagtcaggccttaccaggtggagctg
gtcaggagggactacgtggccaacggcggctgggagaccttcctgtcctacgaggacccg
gagcaggacatcctgatcggtctcctgcgcctgcgccgctgctcgccccagtccttccga
cccgagctgaaaggaggcgtgtccatcgtccgcgagctgcacgtctacggcagcgtggtc
ccagtgagcagccgcgaccccagcaagttccagcaccagggcttcggcatgatgctgatg
gaggaggctgagagaatagccagaggggaacacggctcgcacaaactggctgtcatctca
ggtgtaggaaccagaaactactacaggaagatgggctacgagctggaggggccgtacatg
gtgaagcagctctacggtgcacgactggactga

DBGET integrated database retrieval system