KEGG   Xiphophorus maculatus (southern platyfish): 102228249Help
Entry
102228249         CDS       T02923                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2-like
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102228249
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102228249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295
Motif
Other DBs
NCBI-GeneID: 102228249
NCBI-ProteinID: XP_023189940
Ensembl: ENSXMAG00000009822
Position
5
AA seq 279 aa AA seqDB search
MIIRCRSAHWLILRLWRKAAPEAAAAPPRMECRSAAVSSLSWALVVGGAAYLLRQTRRCG
EYGRYAQPGGRCWPAGPAWFLQEVPSFLVPLLLLGSAEPGSGTGRSLLVWIFMLHYFYRS
CIYSLLTRGRPVPLKIICSSVVFCSLNGFLQGHHLLHCAHLQHTWLTGARLSAGVLVFAV
GLTINIHSDHILRNLRKPGEYVYRIPRGGMFELVSGANFFGEITEWCGFALAAWSFPAFA
FAFFTICSIGPRAYHHHRDYKRRFEDYPRSRKAIIPFIL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgataattcgctgccggagcgctcattggctgatcctgcggctctggcggaaggccgcg
ccggaagcagcagctgcgccgccgcggatggagtgtcgatccgccgccgtgtcgtccctc
agctgggcgctggtggtcggcggggcggcctacctgctgcggcagacgcgccgctgcgga
gagtacggccgctacgcgcagccgggcggccgctgctggcccgccggcccggcctggttc
ctgcaggaggttccgtccttcctggttccgctgctgctgctgggttctgccgaaccgggc
tctggcaccgggaggtcgctgctcgtctggatcttcatgctgcactacttctacaggagc
tgcatctactccctgctgacccgcggacggccggttcctctgaagatcatctgctcctcc
gtcgtcttctgctctctgaacggcttcctgcagggacaccacctgctgcactgcgctcac
ctgcagcacacctggctgaccggcgctcgcctctctgcaggtgttctggtgtttgctgtc
ggtctgaccatcaacatccacagtgaccatatcctgcgtaacctgaggaaacctggggag
tacgtctacaggatcccccgcggggggatgtttgagttagtttctggtgccaacttcttt
ggggagatcaccgagtggtgcggcttcgccctcgctgcttggtcctttccagccttcgcc
tttgccttcttcaccatctgctccatcgggcccagagcctaccatcaccacagggactat
aagcggaggtttgaggactacccccgctccaggaaagccatcattcccttcattctgtag

DBGET integrated database retrieval system