KEGG   Xiphophorus maculatus (southern platyfish): 102229099Help
Entry
102229099         CDS       T02923                                 

Gene name
pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102229099 (pik3cg)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102229099 (pik3cg)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102229099 (pik3cg)
Membrane trafficking [BR:xma04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102229099 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1121 aa AA seqDB search
MDRQQIQVSDEEREVAREDSRRRRRKKAITSASSASMDQISVEFVLPTAARGGSSPDSLL
LEVAGNWTVEQVKAQVWMKAVSLNLCPDFYQRFCPDHCILLYQKKGTVCEIYDKHQVFQT
LDCIRYWRALKRDVGRIQLAPRPQPTDESQQYQRYLNYLIGYDVTDVSNVHDDELEFTRR
KLLTPRRIELSDRDANLYSMDPWVTRKPLPEHLLSKVNNGYILVVIHVSTSSQTIKVSID
DTPSQVLASFFAKTANKRVLLGIPEHLSDEDFVLRVCGREEYLYGEKALQSFNWIRQSLK
NGEEIHLVLETPPDPELDLVQREDWAQVDDCTGVAGTHEQLTIAEKDHERVFTISMWDCN
RKFRVKVLGIDIPTLPKVPELTVFIEASIFHGQQLLAQERTTSKTFNEEVLWNCWLEFNI
KIKDLPKGARLNLQVICGKQPQTPNSKSSYHDNTAGSSTLEGKTKNRLLYYVNLLLIDHR
SLLRQGEFILHMWKMPEKSEESSSSINADKLTSATNPDKASSMAIAILLDKYCYPVVLPK
SREVGRDCGAGGEEGDGGERGQREMPNHLKKQFEAIVSTDPLHPLSPEDKELLWHFRHEC
MRDPRAYPKLLGSVKWGKQEDVLATHCLLDRSNAWDTSGLDVGLAMQLLDCHYSDAQVRS
MAVRKLETLEDDDVLRYLLQLVQAVKFEPYHDSALVRFLLKRALRSKRIGHFLFWFLRSE
IAQSMHYQQRYAVLLEAYLRGCGENMLQDFRKQVEMTEALQKVTREMKAMSADKYDVTQQ
VVIQLRQKLETLQLSGLPESFRVPYDPGLRAGTLLIEQCKVMASKKKPLWLQFKRADPTT
LSKDPVGIIFKDGDDLRQDMLILQILLIMESIWETESLDLCLLPYGCISTGNKIGMIEIV
KDATTIATIQQSVVGSTGAFKDEILYQWLRDKCVSEEKFQQAVERFLYSCGGYCVATYVL
GIGDRHNDNIMITESGNLFHIDFGHILGNYKSFMGISKEWVPFVLTPDFLYVMGTSGKKS
SPHFQKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIREALTVGRSED
EAQRHLLDQIEICREKGWMVQINWFVHLVLGIKQGVEKRST
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggacaggcagcagatccaggtgagtgacgaagagcgcgaagtggcacgggaagacagc
cgcaggaggaggaggaagaaagccatcacctctgcctcctccgcctccatggatcagatc
agcgttgagtttgtgctgcccacagcggcgcggggcgggagcagccccgactctctgctg
ctggaggtggccgggaactggactgtggaacaggtgaaagcccaagtttggatgaaggcg
gtgtctttgaacctctgtcccgacttctaccagcgcttctgtcctgatcactgcatcctc
ctctatcagaagaaaggcactgtgtgcgagatctacgacaagcaccaggtcttccaaacg
ctggactgcattcgctactggagagctctaaagagagacgtgggtcgaatccagctggcg
ccgcgcccgcagcccacagacgagtcccagcagtaccagcgctacctcaactacctgatt
ggctacgacgtgactgacgttagcaacgtccacgacgacgagctggaattcacccgcagg
aagctgctgacgccgcgacgcatcgagctgtcggaccgggacgccaacctttactccatg
gacccctgggtcacccggaagccgctgcccgaacacctcctctccaaggttaataatggt
tacatcctggttgtgatccatgtcagcacctccagccagactatcaaagtctccattgat
gatacgccttcacaggtattggcgagcttctttgcaaaaacggccaataaaagggttttg
ttgggaatccctgaacacttgagcgacgaggactttgtgttgcgtgtgtgtggcagagag
gagtatttgtatggagagaaagccctgcagagcttcaactggatccgtcagtccctcaag
aacggcgaggagatccacctggttctggagactccgcctgatccggagctggatctggtc
cagcgggaggactgggcccaagtggatgactgcacaggcgtcgcaggcacccacgaacag
ctgaccattgctgagaaagaccatgagcgagtgttcaccatctccatgtgggactgcaac
aggaagttcagagtcaaagtgcttggaatcgacatcccgacgctccccaaagtcccagag
cttacggtcttcatcgaggccagcatcttccatgggcagcagcttctggctcaggaaaga
acaacttccaagacgtttaatgaagaagtgctgtggaactgctggctggagtttaacata
aagatcaaggacctacctaaaggggcacgcctcaacctgcaggtgatctgtgggaagcaa
ccccaaacccccaactccaaaagctcctaccacgacaacacagcaggaagctccactctt
gaaggaaagaccaagaaccgcctcctgtactacgtcaacctgctcctgatcgaccaccgc
tccctcctccgccaaggcgagttcatcctccacatgtggaagatgcccgaaaagagcgag
gagagcagcagcagcatcaacgcggacaagctcacgtcggccaccaacccggacaaggcc
tcctccatggccatcgccatcttgttggacaagtactgctacccggtggtgctgcccaag
agcagggaagtgggcagggactgtggggccggcggtgaggagggcgacggaggagagaga
ggacagagagaaatgcccaaccacctgaagaagcagtttgaggcgattgtgtccaccgat
ccattacatcccctgagtccagaggacaaagagctgctgtggcacttcaggcatgagtgc
atgcgtgatccgagggcttacccgaagttgctgggctcagtcaaatgggggaaacaggaa
gacgtcctggctactcactgcctgttggatcgcagcaatgcctgggacaccagtggtctg
gatgttggtctggcgatgcagttgctagactgccactactcggatgcccaggtccgatcc
atggcggtgcggaagctggagacgctggaggacgatgacgtcctccggtatctcctccag
ctcgtccaggcagtgaagtttgagccgtaccatgacagcgccctggtcaggttcctgctg
aagagagcattgaggagtaagcgcatcggccattttctgttctggttcctgcggagtgag
attgcccagtccatgcactaccagcagaggtacgccgtgctgctggaggcctacctcaga
ggctgcggggagaacatgctgcaggacttcaggaagcaggtggagatgacggaggccctt
cagaaagtcacgcgtgagatgaaagccatgtctgccgacaaatatgacgtcacacagcaa
gttgtgatccagctgcgtcagaaactggagaccttgcagttgtcgggccttccggagagt
ttccgagtcccttacgatcccgggctgagagctgggactctgctgatcgagcagtgcaag
gtgatggcgtccaagaagaagccgctgtggctgcagttcaaacgcgccgaccccaccacg
ctgtccaaagaccccgtgggcatcatcttcaaggacggggatgacctgcgacaggacatg
ctcatcctgcagattctgctcatcatggagtccatctgggagacggagtctctggatctg
tgcctcctgccgtacggctgcatctccaccggcaacaagatcggaatgattgagatcgtt
aaagacgccaccacgatcgctaccatccagcagagcgtcgtcggaagcaccggtgccttc
aaggatgaaatcctctaccagtggctgcgggacaagtgtgtcagcgaggaaaagttccag
caggctgtggagaggttcctgtattcctgtggcgggtactgcgtggccacctacgtcctt
ggaatcggagatcgccacaatgacaacatcatgatcacagagtcggggaacctgttccac
atcgacttcggtcacatcctggggaactacaagagcttcatgggaatcagcaaggagtgg
gttcccttcgtgctcacgccggacttcctgtacgtcatgggaacgtcggggaagaagagc
agcccccacttccagaagttccaggatgtgtgtgtgaaggcttacctcgctctccgccat
cacaccaacctgctcatcatcctgttctccatgatgctgatgaccgggatgccgcagctg
accagcaaggaggacatagagtacatccgtgaggcgctgacggtcggccgcagcgaggac
gaggcgcagcgccacctgctggaccagatcgagatctgccgggagaaaggctggatggtt
cagatcaactggttcgtccacctggtgctggggatcaagcagggcgtggagaaacgctcc
acgtag

DBGET integrated database retrieval system