KEGG   Xiphophorus maculatus (southern platyfish): 102229099Help
Entry
102229099         CDS       T02923                                 

Gene name
pik3cg
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102229099 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102229099 (pik3cg)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102229099 (pik3cg)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102229099 (pik3cg)
Membrane trafficking [BR:xma04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102229099 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 1121 aa AA seqDB search
MDRQQIQVSDEEREVAREDSRRRRRKKAITSASSASMDQISVEFVLPTAARGGSSPDSLL
LEVAGNWTVEQVKAQVWMKAVSLNLCPDFYQRFCPDHCILLYQKKGTVCEIYDKHQVFQT
LDCIRYWRALKRDVGRIQLAPRPQPTDESQQYQRYLNYLIGYDVTDVSNVHDDELEFTRR
KLLTPRRIELSDRDANLYSMDPWVTRKPLPEHLLSKVNNGYILVVIHVSTSSQTIKVSID
DTPSQVLASFFAKTANKRVLLGIPEHLSDEDFVLRVCGREEYLYGEKALQSFNWIRQSLK
NGEEIHLVLETPPDPELDLVQREDWAQVDDCTGVAGTHEQLTIAEKDHERVFTISMWDCN
RKFRVKVLGIDIPTLPKVPELTVFIEASIFHGQQLLAQERTTSKTFNEEVLWNCWLEFNI
KIKDLPKGARLNLQVICGKQPQTPNSKSSYHDNTAGSSTLEGKTKNRLLYYVNLLLIDHR
SLLRQGEFILHMWKMPEKSEESSSSINADKLTSATNPDKASSMAIAILLDKYCYPVVLPK
SREVGRDCGAGGEEGDGGERGQREMPNHLKKQFEAIVSTDPLHPLSPEDKELLWHFRHEC
MRDPRAYPKLLGSVKWGKQEDVLATHCLLDRSNAWDTSGLDVGLAMQLLDCHYSDAQVRS
MAVRKLETLEDDDVLRYLLQLVQAVKFEPYHDSALVRFLLKRALRSKRIGHFLFWFLRSE
IAQSMHYQQRYAVLLEAYLRGCGENMLQDFRKQVEMTEALQKVTREMKAMSADKYDVTQQ
VVIQLRQKLETLQLSGLPESFRVPYDPGLRAGTLLIEQCKVMASKKKPLWLQFKRADPTT
LSKDPVGIIFKDGDDLRQDMLILQILLIMESIWETESLDLCLLPYGCISTGNKIGMIEIV
KDATTIATIQQSVVGSTGAFKDEILYQWLRDKCVSEEKFQQAVERFLYSCGGYCVATYVL
GIGDRHNDNIMITESGNLFHIDFGHILGNYKSFMGISKEWVPFVLTPDFLYVMGTSGKKS
SPHFQKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIREALTVGRSED
EAQRHLLDQIEICREKGWMVQINWFVHLVLGIKQGVEKRST
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atggacaggcagcagatccaggtgagtgacgaagagcgcgaagtggcacgggaagacagc
cgcaggaggaggaggaagaaagccatcacctctgcctcctccgcctccatggatcagatc
agcgttgagtttgtgctgcccacagcggcgcggggcgggagcagccccgactctctgctg
ctggaggtggccgggaactggactgtggaacaggtgaaagcccaagtttggatgaaggcg
gtgtctttgaacctctgtcccgacttctaccagcgcttctgtcctgatcactgcatcctc
ctctatcagaagaaaggcactgtgtgcgagatctacgacaagcaccaggtcttccaaacg
ctggactgcattcgctactggagagctctaaagagagacgtgggtcgaatccagctggcg
ccgcgcccgcagcccacagacgagtcccagcagtaccagcgctacctcaactacctgatt
ggctacgacgtgactgacgttagcaacgtccacgacgacgagctggaattcacccgcagg
aagctgctgacgccgcgacgcatcgagctgtcggaccgggacgccaacctttactccatg
gacccctgggtcacccggaagccgctgcccgaacacctcctctccaaggttaataatggt
tacatcctggttgtgatccatgtcagcacctccagccagactatcaaagtctccattgat
gatacgccttcacaggtattggcgagcttctttgcaaaaacggccaataaaagggttttg
ttgggaatccctgaacacttgagcgacgaggactttgtgttgcgtgtgtgtggcagagag
gagtatttgtatggagagaaagccctgcagagcttcaactggatccgtcagtccctcaag
aacggcgaggagatccacctggttctggagactccgcctgatccggagctggatctggtc
cagcgggaggactgggcccaagtggatgactgcacaggcgtcgcaggcacccacgaacag
ctgaccattgctgagaaagaccatgagcgagtgttcaccatctccatgtgggactgcaac
aggaagttcagagtcaaagtgcttggaatcgacatcccgacgctccccaaagtcccagag
cttacggtcttcatcgaggccagcatcttccatgggcagcagcttctggctcaggaaaga
acaacttccaagacgtttaatgaagaagtgctgtggaactgctggctggagtttaacata
aagatcaaggacctacctaaaggggcacgcctcaacctgcaggtgatctgtgggaagcaa
ccccaaacccccaactccaaaagctcctaccacgacaacacagcaggaagctccactctt
gaaggaaagaccaagaaccgcctcctgtactacgtcaacctgctcctgatcgaccaccgc
tccctcctccgccaaggcgagttcatcctccacatgtggaagatgcccgaaaagagcgag
gagagcagcagcagcatcaacgcggacaagctcacgtcggccaccaacccggacaaggcc
tcctccatggccatcgccatcttgttggacaagtactgctacccggtggtgctgcccaag
agcagggaagtgggcagggactgtggggccggcggtgaggagggcgacggaggagagaga
ggacagagagaaatgcccaaccacctgaagaagcagtttgaggcgattgtgtccaccgat
ccattacatcccctgagtccagaggacaaagagctgctgtggcacttcaggcatgagtgc
atgcgtgatccgagggcttacccgaagttgctgggctcagtcaaatgggggaaacaggaa
gacgtcctggctactcactgcctgttggatcgcagcaatgcctgggacaccagtggtctg
gatgttggtctggcgatgcagttgctagactgccactactcggatgcccaggtccgatcc
atggcggtgcggaagctggagacgctggaggacgatgacgtcctccggtatctcctccag
ctcgtccaggcagtgaagtttgagccgtaccatgacagcgccctggtcaggttcctgctg
aagagagcattgaggagtaagcgcatcggccattttctgttctggttcctgcggagtgag
attgcccagtccatgcactaccagcagaggtacgccgtgctgctggaggcctacctcaga
ggctgcggggagaacatgctgcaggacttcaggaagcaggtggagatgacggaggccctt
cagaaagtcacgcgtgagatgaaagccatgtctgccgacaaatatgacgtcacacagcaa
gttgtgatccagctgcgtcagaaactggagaccttgcagttgtcgggccttccggagagt
ttccgagtcccttacgatcccgggctgagagctgggactctgctgatcgagcagtgcaag
gtgatggcgtccaagaagaagccgctgtggctgcagttcaaacgcgccgaccccaccacg
ctgtccaaagaccccgtgggcatcatcttcaaggacggggatgacctgcgacaggacatg
ctcatcctgcagattctgctcatcatggagtccatctgggagacggagtctctggatctg
tgcctcctgccgtacggctgcatctccaccggcaacaagatcggaatgattgagatcgtt
aaagacgccaccacgatcgctaccatccagcagagcgtcgtcggaagcaccggtgccttc
aaggatgaaatcctctaccagtggctgcgggacaagtgtgtcagcgaggaaaagttccag
caggctgtggagaggttcctgtattcctgtggcgggtactgcgtggccacctacgtcctt
ggaatcggagatcgccacaatgacaacatcatgatcacagagtcggggaacctgttccac
atcgacttcggtcacatcctggggaactacaagagcttcatgggaatcagcaaggagtgg
gttcccttcgtgctcacgccggacttcctgtacgtcatgggaacgtcggggaagaagagc
agcccccacttccagaagttccaggatgtgtgtgtgaaggcttacctcgctctccgccat
cacaccaacctgctcatcatcctgttctccatgatgctgatgaccgggatgccgcagctg
accagcaaggaggacatagagtacatccgtgaggcgctgacggtcggccgcagcgaggac
gaggcgcagcgccacctgctggaccagatcgagatctgccgggagaaaggctggatggtt
cagatcaactggttcgtccacctggtgctggggatcaagcagggcgtggagaaacgctcc
acgtag

DBGET integrated database retrieval system