KEGG   Xiphophorus maculatus (southern platyfish): 102229475Help
Entry
102229475         CDS       T02923                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 2-like
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102229475
   00514 Other types of O-glycan biosynthesis
    102229475
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     102229475
Glycosyltransferases [BR:xma01003]
 Terminal extension
  Sialyltransferase
   102229475
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 531 aa AA seqDB search
MKTSMKQWRRLLLVAMLVWVLVFLALLSYFLDARVDESLTSVGSLLYQHPDTRRLASIQA
SNQQHAVFGLKPELALQLTTTYLRDKPGPEPSTSSITSKTSMEASQSPYVTYGSQEAGRQ
EYLDPQSLAAWSSFGTENVGSHSDPAVQSRERVYQNQISATQYHGGEDEDNGREDQDLEH
KVRTAXVGRTGGESSDLEDYYFFRSDSLVQRLWKGHASAGMLSPRLQRAMKNYMSSNKHH
VFYNGHRKGTQSAKELLCQMKAQAQLKTVDGLEEPFSSLGWADFVPSHPLEQLNKQQQDR
SGFKSCAVVTSAGAILRSRLGKEIDAHDAVLRFNAAPTEGYEHDVGSKTTIRIINSQILA
NPSYEFNTSSIYKNITLVAWDPAPYNVNLHKWYDSPDYNLFGPYIDHRKAHPDQPFYILH
PSYVWRLWDVIQSNTQENIQPNPPSSGFIGILLMMALCEQVHVYEYIPSMRQSDLCHYHE
HYYDAACTLGAYHPLLFEKILIQRINKGLESDLRRKGRATLPGFSTIDCGI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccagcatgaagcagtggcggaggctgttgttggtggccatgctggtctgggtc
ttggtctttcttgctctgctctcctacttcctggatgcccgtgtggatgagtctctgacc
tctgttggctctttactctaccagcatcctgacaccaggcggctggcctccatacaagcc
tccaatcagcagcatgccgtctttggtttaaaacctgaactggctttgcaattaactaca
acatatctcagagacaaaccaggaccagaaccttccaccagctccataacctcaaagacc
agcatggaggcaagccagagcccttacgtgacttatggtagccaggaggcgggtcgccaa
gagtatctggacccgcagagcctggctgcctggtcctcctttggtacagagaatgtgggc
tctcattcagaccctgcagtccagagtcgtgagagagtgtaccagaaccagatcagtgcc
actcaataccacggtggtgaggatgaagataatggcagagaagatcaagatcttgagcac
aaagttaggactgcnnnngtcgggagaactggtggagagtcttctgacttggaagattac
tatttcttccgatctgactctttggtgcagaggctgtggaagggccacgcgtccgccggc
atgctcagtccccgactgcagcgcgccatgaagaactacatgagctcaaacaaacatcac
gttttctacaacggacatcggaaaggtacccagagtgccaaagagttgctgtgtcaaatg
aaagcccaggctcagctgaaaacagtggatgggttggaggagcccttctcctctcttggc
tgggccgactttgtgccatcccatccgctggagcagctgaacaaacagcaacaggacagg
agtggtttcaaaagctgtgctgtggtcacctctgctggcgccatcctgcgctccagactg
ggcaaggaaatagacgctcatgatgcagttttgcggttcaacgcagcccctacagaggga
tatgaacatgatgtgggaagcaaaactaccatccgcatcatcaactcacagattttggcg
aatcccagttatgagttcaacacgagctccatctataagaatataacactggtggcctgg
gatcctgcaccttacaatgttaacttgcataagtggtatgatagtccggactataacctg
tttggtccgtacatagatcaccgtaaggcccaccccgaccagcccttctacatccttcat
cccagctacgtgtggcgactgtgggatgtgattcagagcaacactcaggagaacatccag
cccaatcccccctcgtctggcttcataggcattctcctgatgatggcgctgtgtgagcag
gtgcacgtgtacgagtacattccctccatgaggcagtccgacctgtgccactaccacgag
cattactacgatgctgcctgtacactaggcgcctatcaccccctcctcttcgagaagatc
ctgatccagcgcatcaataaggggctcgagagcgacctccggaggaagggacgcgcaact
cttccgggcttcagcaccatcgactgtggcatttga

DBGET integrated database retrieval system