KEGG   Xiphophorus maculatus (southern platyfish): 102229574Help
Entry
102229574         CDS       T02923                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102229574
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     102229574
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102229574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MEHAYYASFGYQITSFFAASSRYGTPDELKEMVDVAHSMGIVVLLDVVHSHASKNTEDGL
NAFDGSDSCFFHSPPRGEHTLWDSRLFNYASFPFKFGPRNEFGHPEWLDFPREGNNQSYH
YARRQFNLLDMDHLRYCQLYAFDRDMNRTEDKYGWLAAQPAYVSAKHEGDKVIVFDRANV
LFIFNFHPNKSFQDYRVGVEAPGKYKIKLDSDEVQYGGHGRLDHNTDFFTEPQPFNGRSN
SMLVYIPCRTAIVLANEEIDYCY
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgcctactacgcaagttttggatatcagattacaagtttctttgctgcttcc
agtcgctatggtaccccagatgagctgaaagagatggttgatgttgctcattcaatgggc
attgtggtgctgctggatgttgtccacagtcatgcatccaagaacacggaggatggcctt
aatgcctttgacgggtccgactcctgcttcttccactcaccgccgagaggggaacacact
ctgtgggacagccgcctctttaactacgccagttttccttttaagtttgggccaagaaat
gagtttggccatcctgagtggctggatttccccagagaaggcaacaatcagagctaccac
tacgcccggcggcagtttaacctgctggatatggatcatctccgctactgtcagctctac
gcctttgaccgggacatgaaccgcaccgaagacaagtacggctggctggcggctcaacct
gcctacgtcagtgccaagcatgaaggggacaaggtcattgtgtttgatagggcaaatgtg
ctctttatcttcaacttccaccccaacaagagcttccaggactacagagtgggtgtggaa
gcaccaggaaaatacaaaatcaagctggattcagacgaggttcagtatggagggcacgga
cggctcgaccacaacactgatttcttcactgagccccaacctttcaacggacgctccaac
tcaatgctggtctacatcccctgcagaacagctattgtcctggccaacgaggagatagat
tactgttattag

DBGET integrated database retrieval system