KEGG   Xiphophorus maculatus (southern platyfish): 102230089Help
Entry
102230089         CDS       T02923                                 

Definition
protein-glutamine gamma-glutamyltransferase 2-like
Orthology
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 699 aa AA seqDB search
MSEVKEVKEGSEDFIVDVDLRSHENNLAHRTREIDRERLIVRRGQPFSITVQCSDSLPPK
HQLELVLHLGKRDEVVVKVQKQRGVGDSWWFSQQEAQGEILLTLQSPADAVIGQYRLVVL
LMSPDGRIVETVDEVSFHVLFNPWCKDDVVYLPDERLLQEYIMNEDGVIFMDTWDYIKSI
PWSYGQFEDFVMDICFEVLDNSKEALHNSKMDIESRSDPIYVSRMVTAMVNANGDRGVLI
GRWRAPYLDGVAPNRWTGSVPILRQWSKSGIRAVKYGQCWVFAGVACTVLRCLGIPTRLI
TNFCSAHDVDGNLSLDFVVDFESREEKTDSKWNFHCWVESWMRRDDLPKGNDGWQVLDPT
PQELSDGEFCCGPCPVAAIKEGNLGVKYDAPFVFAEVNADIVYWNVLPDGQRQQISTDQR
NVGRNISTKSVYGDFREDITLLYKYPEGSVEEREVYKKAKRRATLQPNESVEPAQLSLSI
KHPNPVFGTDFDVIVEVKNEGGDDANVHLTVHAMAVTYNSLHQGECQRQMNNVTVSAQNA
HKEVLRFRYDDYAKCVSDHHLIRVKALAEAQGNSLPIMAVADIPLSLPELHIQVLGKAFV
WEQLTASISFTNPLPVPLTGGVFTLEGAGLLSDTHIYVDGVISPGQKVSVKIAFTPMRTG
VRKLLVDFDSDRLKDVKGVISVVVRKKYRNTLPVLSGRF
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggtcaaagaggtcaaagagggaagtgaggatttcattgtcgacgtggacctg
agaagtcatgaaaacaacttggctcaccgcaccagggagatcgatcgggagcgcttgatt
gtccgcagagggcagcccttctccataaccgtgcagtgctccgactctctgccccccaaa
caccagctggagctcgtcctgcacctgggtaaaagagacgaagtggtggttaaggttcaa
aagcagcggggggtcggagacagctggtggttcagccagcaggaggctcagggggaaata
ttgctgacgctgcagagcccagcagacgccgtcattggacagtaccgtctggtcgtgctg
ctgatgtcaccggatggacgcatcgtggagacagtggacgaagtcagcttccatgtgctg
tttaacccttggtgcaaagatgacgttgtgtacctgcctgatgagagactgcttcaggaa
tacatcatgaacgaagacggagtcatattcatggacacctgggattacatcaaaagcatt
ccctggagttacggacagtttgaggactttgtgatggacatttgttttgaagtcctggat
aattccaaggaggctctgcacaactccaagatggacattgagagcagatctgatccgatc
tacgtcagcaggatggtcaccgcaatggtgaatgccaatggtgacaggggcgtgctgatt
gggcgctggagggcaccgtaccttgatggagtcgcaccaaatcgatggacgggcagcgtg
cccatcctcaggcagtggagcaaatctggcatcagagcagtcaaatacggacagtgttgg
gtgtttgcaggtgtcgcatgtacagttcttcgctgtctgggaatcccaacgcgactcata
accaacttctgctcagctcatgatgtggatgggaatctgtccttggactttgtggtggac
tttgagagcagagaggaaaagacagacagcaaatggaacttccactgttgggtcgagtcc
tggatgaggagagacgatctccctaaaggaaatgatggctggcaggttttggaccccaca
cctcaagaactgagcgatggggagttttgctgcggcccgtgtccagtggcggctatcaag
gagggaaatctgggagtgaagtacgatgctccgtttgtttttgccgaggtgaacgctgac
atcgtttactggaatgtcctaccagacggccagaggcaacagatcagcacggaccagaga
aacgtgggaaggaacatcagcaccaaaagcgtttatggcgacttcagagaagacatcact
ctgctctacaaataccctgagggctctgtggaagagagagaggtttataagaaggcaaag
cgcagggccaccttgcagcccaatgagagcgtagagccggcacagctcagcctgtccatc
aaacatcctaaccccgtgtttggaacagactttgacgtgattgttgaggtgaagaatgaa
ggaggagatgatgctaacgttcatctgacggtgcacgctatggctgtcacttacaactct
ctccaccagggggagtgccagaggcagatgaacaacgtgactgtgtcggctcagaacgct
cataaagaagtgctgcgtttccgctacgacgactacgccaagtgtgtctctgaccatcac
ctgatcagggtgaaagcactggctgaagctcaggggaacagtttgcccatcatggctgtg
gcggacatcccactgagcttacctgagctccacattcaggttcttgggaaggcttttgtt
tgggaacagctgacggcctctatctccttcaccaatccgctgccagtccctctgactggt
ggtgtgttcaccctggagggggctggcctgctgtctgacactcacatctacgtcgatggt
gtcatttctccaggccagaaggtgtcggtgaaaatcgccttcaccccgatgagaaccggg
gtcaggaagctgctggtggacttcgactctgacaggctgaaggacgtcaagggagtcatc
tctgtggttgttagaaagaaatacaggaataccttgcctgttttgagtggaaggttttag

DBGET integrated database retrieval system