KEGG   Xiphophorus maculatus (southern platyfish): 102230116Help
Entry
102230116         CDS       T02923                                 

Definition
(RefSeq) choline/ethanolamine kinase
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00564  Glycerophospholipid metabolism
xma01100  Metabolic pathways
Module
xma_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
xma_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102230116
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     102230116
    2.7.1.82  ethanolamine kinase
     102230116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase
Motif
Other DBs
NCBI-GeneID: 102230116
NCBI-ProteinID: XP_005802124
Ensembl: ENSXMAG00000004650
Position
2
AA seq 487 aa AA seqDB search
MRFRTSSYAWLFRLSGFIGEQCVSASPLRCLIRPTFYGGVHLLLALKLTMQSGRNATHSN
SGANVLDTAEKTGQGLHSSNVSSHTLSSEGVCPSAGRKRVVTSLLVSERYLRTPSPQVDD
DSEAESFRDGRSEEVDRDTKSRAFLWCRDFLSGSWKTVQEADFQISIVSGGLSNLLYLCI
LPDHVPCLGEEPRQVLLRVYGAILQGVDSLVLESVMFAILAERTLGPKLYGIFPEGRLEQ
YLPNTRMLTEQLSDPVISSEIATKLARFHGMVMPFNKEPKWLFGTIDKYMDEVMKIHFVR
ETHVKKYNKLMQFDLPAELKSLRSLLAATPSPVVFCHNDVQEGNILILEDRDHTSTEKLM
LIDFEYSSYNYRGFDFGNHFCEWTYDYTWNEWPFYKVTPENYPTREQQLHFIRSYLAEQN
RHTKSHLDQTKIEEDMIIEANRYALASHFLWGLWSIIQAKLSKIEFGYMDYAQSRFDAYF
KQKKLFS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcaggacatccagctatgcttggctctttcggttgagcggctttattggtgaa
cagtgtgtgtcagcgagcccgttgcgctgcctcatcagaccgacattttacggcggtgtt
catttactcctcgccctcaaactcacgatgcagtctggtcgaaatgcgacccatagcaac
tccggcgcgaatgtcttggacacagctgagaaaacgggacaagggctccacagcagcaac
gtttccagccacaccctctcctcggaaggcgtctgtccgtcggcagggaggaagcgagta
gtgacctcgcttttggtcagtgagagatacctgaggaccccgagtcctcaggtagatgac
gactccgaagcggagtcttttcgggatgggagaagcgaagaggtcgaccgagatacaaaa
agcagagcgtttttgtggtgcagggactttctgtctggatcatggaaaactgttcaagaa
gcggattttcaaattagtatcgtcagtggtggactgagtaatctactgtacctgtgtatc
ttgcctgaccatgtcccatgtttgggggaagaaccccggcaggtgctgctgagagtctac
ggtgccatcttgcagggtgtggattctctggtactggaaagtgtgatgtttgctattttg
gcagagcgaactttggggccaaagctttatggtatctttccagagggacgtttggagcaa
tacttaccaaacacccgcatgctcacagaacaactctccgacccggttatttcgtctgag
attgccaccaaactggcacggtttcatggcatggttatgccctttaacaaagagcccaag
tggctgttcgggaccattgacaaatacatggatgaagtaatgaagattcattttgtgcgg
gaaacgcatgtgaaaaagtacaataaactgatgcagtttgatctgcctgctgagctcaag
agtctccggtctttgctggcagcgactccatcaccagtggtgttttgtcataatgatgtc
caagaaggaaacatccttatcctggaggacagggaccacacatcgacagaaaaactgatg
cttattgactttgaatacagcagttacaattacaggggttttgactttgggaaccatttc
tgcgagtggacgtatgattacacgtggaatgagtggccgttttacaaagttacacctgag
aactatccgaccagagagcagcagcttcacttcatcagaagttatttggctgagcaaaat
cgacacaccaagagtcacctggatcagacaaaaattgaagaggatatgataattgaagca
aacaggtatgcattagcatcgcatttcctctggggactgtggtccatcattcaggccaag
ttatccaagattgagtttggatatatggattatgctcagagccgttttgacgcctacttc
aagcagaaaaagctcttctcctaa

DBGET integrated database retrieval system