KEGG   Xiphophorus maculatus (southern platyfish): 102230251Help
Entry
102230251         CDS       T02923                                 

Gene name
lyz
Definition
(RefSeq) lysozyme C
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102230251 (lyz)
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102230251 (lyz)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT
Motif
Other DBs
NCBI-GeneID: 102230251
NCBI-ProteinID: XP_005817273
Ensembl: ENSXMAG00000011983
UniProt: M4AC10
Position
8
AA seq 152 aa AA seqDB search
MKVLVVLAVLLLAAVLVDGRVFERCQWARTMKNYGMDGYWGISLANWMCLTYSESSYNTT
AVNHNRDKSTDYGIFQINSRWWCNDTRIRTANGCHIMCEQLLSDDVGVAISCAKRVVRDP
QGIAAWVGWRTHCKNQDVSKYLDGCGLDSSFL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctggtggttctggcggttctgctgctggcggcggttctggtggacggcaga
gtgtttgagcggtgccagtgggcccgaaccatgaagaactacgggatggacgggtactgg
ggcatcagcctggccaactggatgtgtctgacttactctgagtcgagctacaacactacg
gcagtcaaccacaaccgggacaaatccaccgactacggcatcttccagatcaacagccgc
tggtggtgcaacgacacccggatcagaaccgccaacggatgtcacatcatgtgtgaacag
ctgctgagtgacgatgtgggcgtggccatcagctgtgcgaagcgtgtggtcagggatccc
cagggcatcgccgcctgggtgggctggaggacgcactgcaaaaaccaggatgtgagtaaa
tatttggacggatgcggcctggattcctcatttctttaa

DBGET integrated database retrieval system