KEGG   Xiphophorus maculatus (southern platyfish): 102230435Help
Entry
102230435         CDS       T02923                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 2-like
Orthology
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102230435
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102230435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 252 aa AA seqDB search
MHCYESVVNYLSCGMLLAGLLHLINHRKAQASYGRHMKPTAPAILVPARVAWFLQEMPAL
LMPLLLMHLSRQYSTMGRAILLKTFCLHYFHRTFVYSLLTRGQPFPLSVMATAGFFCLLN
GSLQGHYLLHCAQFDEEWSADYRYTIGLVVFYIGMAINIHSDYILRNLRKPKEIVYKIPA
GGLFEYVSGANYFGELVEWFGYAIVTWSLPGFSIAVFSLCFIGPRAYYHHKFYKEHFKEY
PRFRKALIPFIF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcactgctatgagagcgtggtgaactatctgagctgtgggatgctgctggcaggactt
cttcacctgatcaatcacaggaaggcacaggcctcctatggacgccacatgaaacccacc
gctccagctattctggtccctgccagagttgcctggttcctgcaggagatgccagctctt
ctgatgccgctgctgctgatgcacctttcacgccaatattctactatggggagagccata
ttgctaaagaccttctgtctgcactatttccacaggacatttgtgtattcccttctgacc
agaggacagcctttccctctgagtgtgatggccacagcaggcttcttctgcttgttgaac
ggttctctgcagggtcactatctgctgcactgtgcccagtttgatgaggaatggtcagct
gactaccgctatacaattggcttagtggtgttttacatcggaatggccattaatatacac
agcgattacattctgcgcaacctgaggaaacctaaagagatagtttacaaaattccagca
ggaggcttatttgaatatgtgtctggtgccaactactttggggagctggtggagtggttt
ggctatgccatagtgacatggtcccttccagggttctcgatcgctgtttttagcctctgt
tttattggaccaagagcctattaccatcacaagttttataaggaacattttaaagaatac
cccaggtttcgaaaggctttgattccattcatcttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system