KEGG   Xiphophorus maculatus (southern platyfish): 102230576Help
Entry
102230576         CDS       T02923                                 

Definition
(RefSeq) CREB-binding protein isoform X4
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04068  FoxO signaling pathway
xma04110  Cell cycle
xma04310  Wnt signaling pathway
xma04330  Notch signaling pathway
xma04350  TGF-beta signaling pathway
xma04520  Adherens junction
xma04916  Melanogenesis
xma05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102230576
   04330 Notch signaling pathway
    102230576
   04350 TGF-beta signaling pathway
    102230576
   04068 FoxO signaling pathway
    102230576
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102230576
  Cellular community - eukaryotes
   04520 Adherens junction
    102230576
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    102230576
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102230576
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102230576
Transcription factors [BR:xma03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102230576
Chromosome [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102230576
Mitochondrial biogenesis [BR:xma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102230576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 102230576
NCBI-ProteinID: XP_014328089
Ensembl: ENSXMAG00000004557
Position
16
AA seq 2446 aa AA seqDB search
MADNLLDAGPPTAKRPKINSPISGSDGPDLVSLLDLENDLPDELILNGELGNGPSANCGP
SGMPPGLNSAIPDAASKHKQLSELLRPGSSSILGGPLNSGSPQQGGMVPSQLGAVLGKGP
LGQGSPNHQSPQGQKGVSTGQGNGVLGFNQTMLNSGQGHGVMGQVGQVMNGAMGPAGRGR
PGPGMQYQGQAMQGTQGGAGPGVGGSVLAETLTQGGPQMGAPHTMNAQQAGNMNKMVMSG
APFGQQYGQAGVQQMGTAGVNAQQLQNKTALSNNLPPFPADLKGAGNVPNMAQMQQQVTS
MGMVPGAGGVSGGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACTLPHCRTMKN
VLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQPMLSSPG
ASLQNAISTVGPGQPSATAINSAPTHIDPSSMQRAYAALGLPYGNHSPAQVQGQGPAQQN
PQAHQQLRNMNSLGTNQMNQMAGGLGSHSSDQTGLLSDSSLPSSLNNRQLLPDGSEVEGM
GNLPAATPLSASGVRKAWHEHVTQGLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAR
KVEGDMYESANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQPIMVGAPGPQQPGMAQPN
SMGPAQAVRPPNGPATMPNMPNQMMNRMQVDQGINQFNPMAMQNAQMPQAPMGARAPSPM
SHPQQMNMNSVMGMSPSRMPPNQGMMGNHANSMTQPATQGQYLQQGQYPGAAGGAMNVNI
GMGQTMPQAAVAQQQQTSNLPLNALGSQLPSGPTTQPTRGTPPPPSISQQQQQQQQQQQQ
QQQQQQQHAPTQAQVPQQPSTPGSAVGHPSTPTHIPSSLPRPPAAMSTPPDPSQPLTPLQ
PPSEPPSQMQQPTSVQPQHPSTPLSQAAAGIDNRVPTPGSVAELSSLQALPDMTSSEVKS
EVKEEEEEEEDSKSGKKQNDVKMEQDDETKPSLVKKEEMDAAEPKQEPMETDEKKPEVKV
EPKEEEDGASTSTSATSTAQNRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPMV
LGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCT
KLAEVFEAEIDPVMQVLGYCCGRKYEFSPQTLCCYGKQLCTISRDSTYYSYQNRYHYCEK
CFNEIQGNSVNLGDDPAQPQTKISKDQFEKKKNDTLDPEPFVECKDCGRKMHQICVLHYD
VIWPSGFVCDNCLRKSGKTRKENKFSAKRLQTTRLGTYIEDRVNKYLKRQNHPEAGEVFV
RVVASSDKTVDIKPGMKSRFVDSGEMMANFPYRTKALFAFEEIDGVDVCFFGMHVQEYGS
DCPFPNTRRVYISYLDSVHFFKPRVLRTAVYHEILIGYLEYVRKLGYVMGHIWACPPSEG
DDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERIIHDYKDIFKQATEDRLTSANELPY
FEGDFWPNVLEESIKELEQEEEERKKEENTASSETTEGVQADSKNAKKKNNKKTNKNKSS
VSRSNKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPVINTLPPIMDPDPLLTCD
LMDGRDAFLTLARDKHWEFSSLRRCKWSSMCMLVELHNQGQDRFVYTCNECKHHVETRWH
CTVCEDYDLCINCYNTKGHEHQMVKWGLGIDDDSNSQSGEASKSPQESRRLSIQRCIQSL
VHACQCRNANCSLASCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCP
VPFCLNIKQKLRQQQLQHRLQQAQMMRRRMATMAGRGMPMPSPPTSAAPETPTSVQQPNT
PQTPQPMPNHPQQQQPPPNPGNMGQGFPSNGRSSQPSTPVPQGKPGPQSSPLHQQLSPMP
NMPHQQQAPPPQQPQQQQQQLLAAMKVAQQIEMAAKAKQQQQQGYAMNGMPMNQSRMMNP
IQNQMQMMPGPRGPQVMQAVSQGQWGVGMQNAQGHQPLVPPQQGPMASHQAQGTPMSQQS
PLMQRPVMPQQSGPQMPGVMPPQGPPQQGMTSQQQPNMPRVMPGNITPSAVQELLHTLKS
PSSPQQQQQVLTILKSNPHLMAAFIKQRAAKYQASQAVPQQQQQQQQQQVQQQQQVQQQN
PQVLLGSQPGMQAMAAMNQMQRTGMAPQQQPPQLVGPQGMPPMGPQGQMMNTAQNGNPQY
HRQLLRMQQMQQQGGMPQGHSQFPTQQQGPPGFSQLRAHQQMAMQGGSGPMGSVPPMSQM
GQPGMGMEGIPNHLKQRMLQHQMMKQQMGSPGQANPMSPQPHLLQGQGQTAAHLSGQTMA
NTLGNQVRSPAPVQSPRPPSQQAPHSGSSPRIQPQPSPQHGALHSSSPHPSLGPMSGSMD
QGHMGTPEQSAMLPQLNTPNRGGLSNDMNMVGDTTGDTLERFVEGL
NT seq 7341 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatctgctggatgcgggaccccctactgcaaagcgacccaagattaattca
cccatatcgggatcagacggcccagatcttgtatcgttgcttgatctggaaaacgacctt
cctgatgaacttatcctcaatggagagttaggaaatgggccgtctgctaattgtggtcca
agtggcatgccacctggtctcaactcggctatacctgatgccgcctccaaacacaagcaa
ctttctgagctcctgcgacccggaagctcatctattctggggggtccgctcaattctggc
agtccccaacagggaggcatggtgccgagccagctgggtgcggtgctgggcaaagggcct
ctgggccagggctcacccaatcatcagtcgccccaaggccagaaaggtgtttccactgga
caaggaaatggagtcctgggctttaaccagacgatgttgaacagtggtcagggtcatggt
gttatgggccaagtgggacaggtcatgaatggtgctatgggaccagcaggccgagggaga
cctgggcctggcatgcagtaccaaggccaagcaatgcaggggacacaaggaggcgctgga
cctggtgttggaggaagtgtgctggcagagactctgacccaaggaggacctcagatgggt
gcaccgcacaccatgaatgcccaacaagctggaaacatgaacaagatggtgatgtcagga
gctccgttcggccagcagtatggtcaggccggggtgcagcagatggggacagcaggggtc
aatgcccaacaactccagaacaagacggccctttctaacaacctgcccccattccctgct
gacttaaagggagctgggaatgtgccaaacatggcccagatgcagcagcaggtaacatcg
atgggtatggtcccgggggctggcggcgtatctggagggccgactgccgaccccgagaaa
cgaaaactcattcagcagcagctggtcctgctgctccacgcacacaagtgccaacggcgg
gaacaggccaatggagaagtgagggcctgtactctgcctcactgccgcaccatgaagaac
gtactcaaccacatgactcactgccaagctggcaagtcttgccaggtggctcactgtgca
tcatccaggcagatcatctctcactggaagaactgtacacgacacgactgccccgtctgc
ttgcctttaaagaatgcaagtgacaagagaaatcagcagcccatgttgagctctcccgga
gccagcctgcagaatgccatcagtacagtcggacccggccagccgagcgccacagccatc
aacagcgctcccacacacattgaccccagctctatgcagagggcttacgcagctctgggc
ctcccatatgggaaccattcccctgctcaggtccagggtcagggtccggctcagcagaac
ccccaggcacaccagcagctacgaaatatgaactcactcggcactaatcagatgaaccag
atggcaggaggcctgggtagccattcctccgaccagacgggcttgctctccgactcctcg
ctcccctcttcgctcaacaacaggcagctactgccagatggatcagaggtagaaggtatg
ggaaacctccccgctgccaccccgctctctgcttcaggggtaagaaaggcctggcatgaa
cacgtgactcagggcctgcgctcccatctggtgcacaaactagtacaagccatattcccg
accccagaccctgcagctctgaaggacaggcgaatggagaacttggtggcttacgcacgc
aaagttgagggagacatgtatgagtcagcaaacagcagggatgagtactaccacttcctg
gcagaaaaaatttacaagatccagaaagagctggaggagaagagacgctcgcgtctgcag
aaacagcccatcatggtgggcgctcccggaccccagcagcctggtatggctcagcccaac
agcatgggccctgcacaggccgttcgacctccaaatggacctgcaacaatgcccaacatg
ccaaatcagatgatgaaccgtatgcaggtggatcaaggaatcaatcagtttaacccaatg
gcgatgcagaatgcacagatgcctcaggcacccatgggagcgagggctccttccccaatg
agccatccgcagcagatgaacatgaattctgtgatgggcatgtctccatccaggatgccc
ccgaaccaaggcatgatgggtaatcatgctaatagcatgactcaaccagccacccaaggc
cagtacctgcagcagggtcagtatcctggtgctgcaggtggagccatgaatgtgaatata
ggcatgggtcagactatgccacaggctgccgttgcacagcaacaacaaacctctaacctc
cctctgaatgcactgggctcccagttgccctctggacccaccacccaacccacccggggc
accccccctccacccagcatcagccagcagcagcagcagcagcagcagcagcagcagcag
cagcagcagcagcagcagcagcatgctcccacacaggcccaggtgccgcagcagccctcc
actcctggctctgcagtaggacacccctctaccccaacccacattccaagtagccttcct
cgcccccctgcagctatgagcactccccctgacccctcccagcctctgacacccctgcag
cctccttctgagccccccagccagatgcagcagcccacctctgtgcagcctcagcaccct
agtacaccgttgtcccaggctgctgccggtattgataacagagtacccactcctggctct
gtggctgaactgagctccctgcaggctctgcctgacatgaccagctctgaggtcaaatcc
gaagtcaaagaggaagaagaagaggaggaggacagcaagtctggaaaaaagcaaaatgat
gtaaagatggaacaggacgatgaaaccaaaccctccctggtgaagaaggaggaaatggat
gcagcagaaccaaagcaggaacccatggagacggacgagaagaagccagaggtgaaggtg
gaacccaaagaagaggaggacggtgcgtccaccagcacatcagccacttccactgctcag
aaccgcaaaaaaattttcaagccagaggaactgagacaagcactgatgcccactcttgag
gccctctacagacaagaccccgagtccctacccttcaggcaacctgtagaccccatggtg
ctcggcattcctgactactttgacatagtgaagaaccccatcgacttatccaccatcaaa
cgcaagctggacacgggtcagtaccaggagccgtggcagtatgtggatgacatctggctc
atgttcaacaacgcctggctgtataaccgcaaaacgtcacgcgtctacaagtactgcacc
aagctggccgaggtgttcgaagcagagattgatcccgtcatgcaggttctgggctactgc
tgtggcaggaagtacgagttttcacctcagacgctttgttgctacggcaaacagttgtgt
accatctccagagacagcacctactacagctaccagaacaggtatcactattgtgagaag
tgcttcaatgagatccagggcaacagtgtgaacctgggggacgacccggcacaaccgcag
acgaaaatatctaaagatcagtttgaaaagaagaaaaatgatacgttggaccctgaaccg
tttgttgaatgtaaagactgtggaagaaaaatgcatcagatctgtgtgctgcactacgat
gtcatttggccctctggcttcgtttgtgacaattgcctgagaaaatcaggaaaaacaagg
aaggagaacaagttctcagcaaaaaggttgcagactacaaggttggggacgtacattgaa
gacagagtaaacaagtacttaaaaaggcagaaccacccagaagctggtgaagtgtttgtg
cgagttgttgccagctctgataaaactgtggatattaagcctggcatgaagtctaggttt
gtagactcaggtgagatgatggcgaacttcccttacagaaccaaagcactttttgcattc
gaggaaatcgatggcgtggacgtttgtttcttcggcatgcatgtacaggagtatggctca
gattgcccttttccaaacacaagacgggtttacatatcatacctcgacagtgttcacttc
ttcaagccacgtgtgctaaggactgcagtgtaccacgagatcttgataggctacctggag
tatgtgaggaaacttgggtatgtaatgggtcacatttgggcctgcccaccaagtgaagga
gatgattatattttccactgccaccctccggaccagaagatccctaaacccaaaaggctg
caggagtggtacaggaagatgcttgacaaggcgtttgcagagaggatcattcatgattac
aaggacattttcaagcaggcaacagaagacaggttgaccagtgccaacgagctgccatac
tttgagggcgacttttggcctaatgtgctggaggagagcatcaaggagctggagcaggag
gaggaggagagaaaaaaggaggagaacactgcctcctcggagacaacagagggagtccag
gctgacagcaagaatgccaaaaagaagaataataagaaaaccaacaagaacaagagcagc
gtcagccgatccaataagaagaagcctggcatgccaaatgtagccaatgatctgtctcaa
aaactctacgccaccatggagaaacacaaggaggtgttttttgtaattcacctccattcg
gggcctgtcatcaacaccctcccacctatcatggaccccgaccctctgctgacctgtgac
ctcatggacggacgtgacgccttcctgactttggccagggacaagcactgggagttcagc
tcgctcagaagatgcaagtggagctccatgtgcatgctggtggagctgcacaaccagggc
caggaccgctttgtctacacatgcaacgaatgcaagcatcatgtggagactcgctggcac
tgcactgtttgtgaggactatgacctgtgcattaactgctacaacactaagggccacgag
caccagatggtgaagtggggcctgggtatcgatgatgacagcaacagtcagagcggcgag
gcctcaaagagtcctcaggagagtcggcgcctcagcatccagcgctgcatccagtctctg
gtccacgcctgtcagtgcaggaacgccaactgctccctcgcgtcctgccagaagatgaag
cgggtggttcagcacactaagggctgcaagcgcaagaccaatggtggatgcccggtgtgc
aagcagctgattgctttatgctgttaccacgccaagcactgtcaggagaacaagtgtccg
gttccgttctgcctcaacatcaagcagaagcttcgtcagcagcagttgcagcacaggctg
cagcaggcccagatgatgcgccgcagaatggccaccatggctggaagaggtatgccgatg
ccatctccacctacctcagctgctccagaaacccccacgtctgtgcagcaacctaacacg
ccccagactccacaacccatgcctaaccaccctcagcaacagcaaccaccaccaaacccc
ggcaacatgggccaagggttccccagcaacggccgcagcagtcagccctccacgcctgtg
ccgcaaggtaaacctggcccacagtcatcgccgctccatcagcagctgtcccctatgcct
aacatgccgcatcagcagcaggctcctcctcctcagcagccgcagcaacagcagcagcag
ctgctggcagcaatgaaagtggcacaacagatcgagatggcggcaaaggcaaagcagcag
cagcagcagggttacgccatgaacgggatgcccatgaaccagtcacgcatgatgaacccc
attcagaaccaaatgcagatgatgccgggtccccggggtccccaggtgatgcaggctgtg
tcgcagggtcagtggggtgtgggaatgcagaatgcccaaggccatcagccactggtccct
cctcagcaaggccccatggcctcccaccaggctcagggaacccccatgtctcagcagtcc
ccactcatgcagaggcccgtgatgccacagcagtcgggtccccaaatgcctggggtcatg
cctcctcaggggcccccccaacagggaatgacatcgcagcagcagccaaacatgccccgg
gtaatgcctggaaatattacgccaagtgccgtgcaggaactactgcacaccctcaagtct
ccgagctccccacagcaacagcagcaggtgctgaccatccttaagtccaatccccacctc
atggccgctttcatcaaacagagagcggccaagtaccaggccagccaggcggtgccgcag
cagcagcagcaacagcagcagcaacaagtccagcagcagcaacaggtccagcagcagaac
cctcaggtcctgctgggctcccagcctgggatgcaggccatggcagctatgaaccaaatg
cagaggaccgggatggctccgcagcagcagcctcctcagctggtgggccctcagggtatg
ccccccatgggtcctcaaggccagatgatgaatacggctcaaaacggaaaccctcagtac
cacagacagctgctccgaatgcagcagatgcagcagcaggggggcatgcctcagggccac
agccagttccccacccagcagcaggggcccccaggcttctcccagctccgcgcgcatcag
cagatggctatgcaagggggctccggtccaatggggtcggttcctcccatgtcgcagatg
ggccagcccggcatgggtatggaagggatcccgaaccacctcaagcagcgcatgcttcag
catcagatgatgaagcagcagatgggttctcctgggcaggccaacccgatgagtcctcaa
cctcatctgctgcagggccaaggccagaccgcagctcatctatctggtcagaccatggct
aacaccctgggaaaccaggtccgctccccggctccggtgcagtcgccccggccgccttca
caacaagccccccattccggttcctccccgcggatacaaccccagccttcgccgcagcac
ggggctctccactccagctcccctcacccaagcctcggccccatgtcaggctctatggac
cagggacacatgggaacgcctgagcaaagcgcaatgctcccacagctgaacacaccaaac
cgaggagggctgagcaacgacatgaacatggtgggcgacacaacaggagacacgctagag
aggttcgttgaaggattgtag

DBGET integrated database retrieval system