KEGG   Xiphophorus maculatus (southern platyfish): 102230576Help
Entry
102230576         CDS       T02923                                 

Gene name
crebbp
Definition
(RefSeq) CREB binding protein
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102230576 (crebbp)
   04330 Notch signaling pathway
    102230576 (crebbp)
   04350 TGF-beta signaling pathway
    102230576 (crebbp)
   04630 Jak-STAT signaling pathway
    102230576 (crebbp)
   04068 FoxO signaling pathway
    102230576 (crebbp)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102230576 (crebbp)
  Cellular commiunity
   04520 Adherens junction
    102230576 (crebbp)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    102230576 (crebbp)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102230576 (crebbp)
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102230576 (crebbp)
Transcription factors [BR:xma03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102230576 (crebbp)
Chromosome [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102230576 (crebbp)
Mitochondrial biogenesis [BR:xma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102230576 (crebbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2446 aa AA seqDB search
MADNLLDAGPPTAKRPKINSPISGSDGPDLVSLLDLENDLPDELILNGELGNGPSANCGP
SGMPPGLNSAIPDAASKHKQLSELLRPGSSSILGGPLNSGSPQQGGMVPSQLGAVLGKGP
LGQGSPNHQSPQGQKGVSTGQGNGVLGFNQTMLNSGQGHGVMGQVGQVMNGAMGPAGRGR
PGPGMQYQGQAMQGTQGGAGPGVGGSVLAETLTQGGPQMGAPHTMNAQQAGNMNKMVMSG
APFGQQYGQAGVQQMGTAGVNAQQLQNKTALSNNLPPFPADLKGAGNVPNMAQMQQQVTS
MGMVPGAGGVSGGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACTLPHCRTMKN
VLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQPMLSSPG
ASLQNAISTVGPGQPSATAINSAPTHIDPSSMQRAYAALGLPYGNHSPAQVQGQGPAQQN
PQAHQQLRNMNSLGTNQMNQMAGGLGSHSSDQTGLLSDSSLPSSLNNRQLLPDGSEVEGM
GNLPAATPLSASGVRKAWHEHVTQGLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAR
KVEGDMYESANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQPIMVGAPGPQQPGMAQPN
SMGPAQAVRPPNGPATMPNMPNQMMNRMQVDQGINQFNPMAMQNAQMPQAPMGARAPSPM
SHPQQMNMNSVMGMSPSRMPPNQGMMGNHANSMTQPATQGQYLQQGQYPGAAGGAMNVNI
GMGQTMPQAAVAQQQQTSNLPLNALGSQLPSGPTTQPTRGTPPPPSISQQQQQQQQQQQQ
QQQQQQQHAPTQAQVPQQPSTPGSAVGHPSTPTHIPSSLPRPPAAMSTPPDPSQPLTPLQ
PPSEPPSQMQQPTSVQPQHPSTPLSQAAAGIDNRVPTPGSVAELSSLQALPDMTSSEVKS
EVKEEEEEEEDSKSGKKQNDVKMEQDDETKPSLVKKEEMDAAEPKQEPMETDEKKPEVKV
EPKEEEDGASTSTSATSTAQNRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPMV
LGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCT
KLAEVFEAEIDPVMQVLGYCCGRKYEFSPQTLCCYGKQLCTISRDSTYYSYQNRYHYCEK
CFNEIQGNSVNLGDDPAQPQTKISKDQFEKKKNDTLDPEPFVECKDCGRKMHQICVLHYD
VIWPSGFVCDNCLRKSGKTRKENKFSAKRLQTTRLGTYIEDRVNKYLKRQNHPEAGEVFV
RVVASSDKTVDIKPGMKSRFVDSGEMMANFPYRTKALFAFEEIDGVDVCFFGMHVQEYGS
DCPFPNTRRVYISYLDSVHFFKPRVLRTAVYHEILIGYLEYVRKLGYVMGHIWACPPSEG
DDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERIIHDYKDIFKQATEDRLTSANELPY
FEGDFWPNVLEESIKELEQEEEERKKEENTASSETTEGVQADSKNAKKKNNKKTNKNKSS
VSRSNKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPVINTLPPIMDPDPLLTCD
LMDGRDAFLTLARDKHWEFSSLRRCKWSSMCMLVELHNQGQDRFVYTCNECKHHVETRWH
CTVCEDYDLCINCYNTKGHEHQMVKWGLGIDDDSNSQSGEASKSPQESRRLSIQRCIQSL
VHACQCRNANCSLASCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCP
VPFCLNIKQKLRQQQLQHRLQQAQMMRRRMATMAGRGMPMPSPPTSAAPETPTSVQQPNT
PQTPQPMPNHPQQQQPPPNPGNMGQGFPSNGRSSQPSTPVPQGKPGPQSSPLHQQLSPMP
NMPHQQQAPPPQQPQQQQQQLLAAMKVAQQIEMAAKAKQQQQQGYAMNGMPMNQSRMMNP
IQNQMQMMPGPRGPQVMQAVSQGQWGVGMQNAQGHQPLVPPQQGPMASHQAQGTPMSQQS
PLMQRPVMPQQSGPQMPGVMPPQGPPQQGMTSQQQPNMPRVMPGNITPSAVQELLHTLKS
PSSPQQQQQVLTILKSNPHLMAAFIKQRAAKYQASQAVPQQQQQQQQQQVQQQQQVQQQN
PQVLLGSQPGMQAMAAMNQMQRTGMAPQQQPPQLVGPQGMPPMGPQGQMMNTAQNGNPQY
HRQLLRMQQMQQQGGMPQGHSQFPTQQQGPPGFSQLRAHQQMAMQGGSGPMGSVPPMSQM
GQPGMGMEGIPNHLKQRMLQHQMMKQQMGSPGQANPMSPQPHLLQGQGQTAAHLSGQTMA
NTLGNQVRSPAPVQSPRPPSQQAPHSGSSPRIQPQPSPQHGALHSSSPHPSLGPMSGSMD
QGHMGTPEQSAMLPQLNTPNRGGLSNDMNMVGDTTGDTLERFVEGL
NT seq 7341 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaatctgctggatgcgggaccccctactgcaaagcgacccaagattaattca
cccatatcgggatcagacggcccagatcttgtatcgttgcttgatctggaaaacgacctt
cctgatgaacttatcctcaatggagagttaggaaatgggccgtctgctaattgtggtcca
agtggcatgccacctggtctcaactcggctatacctgatgccgcctccaaacacaagcaa
ctttctgagctcctgcgacccggaagctcatctattctggggggtccgctcaattctggc
agtccccaacagggaggcatggtgccgagccagctgggtgcggtgctgggcaaagggcct
ctgggccagggctcacccaatcatcagtcgccccaaggccagaaaggtgtttccactgga
caaggaaatggagtcctgggctttaaccagacgatgttgaacagtggtcagggtcatggt
gttatgggccaagtgggacaggtcatgaatggtgctatgggaccagcaggccgagggaga
cctgggcctggcatgcagtaccaaggccaagcaatgcaggggacacaaggaggcgctgga
cctggtgttggaggaagtgtgctggcagagactctgacccaaggaggacctcagatgggt
gcaccgcacaccatgaatgcccaacaagctggaaacatgaacaagatggtgatgtcagga
gctccgttcggccagcagtatggtcaggccggggtgcagcagatggggacagcaggggtc
aatgcccaacaactccagaacaagacggccctttctaacaacctgcccccattccctgct
gacttaaagggagctgggaatgtgccaaacatggcccagatgcagcagcaggtaacatcg
atgggtatggtcccgggggctggcggcgtatctggagggccgactgccgaccccgagaaa
cgaaaactcattcagcagcagctggtcctgctgctccacgcacacaagtgccaacggcgg
gaacaggccaatggagaagtgagggcctgtactctgcctcactgccgcaccatgaagaac
gtactcaaccacatgactcactgccaagctggcaagtcttgccaggtggctcactgtgca
tcatccaggcagatcatctctcactggaagaactgtacacgacacgactgccccgtctgc
ttgcctttaaagaatgcaagtgacaagagaaatcagcagcccatgttgagctctcccgga
gccagcctgcagaatgccatcagtacagtcggacccggccagccgagcgccacagccatc
aacagcgctcccacacacattgaccccagctctatgcagagggcttacgcagctctgggc
ctcccatatgggaaccattcccctgctcaggtccagggtcagggtccggctcagcagaac
ccccaggcacaccagcagctacgaaatatgaactcactcggcactaatcagatgaaccag
atggcaggaggcctgggtagccattcctccgaccagacgggcttgctctccgactcctcg
ctcccctcttcgctcaacaacaggcagctactgccagatggatcagaggtagaaggtatg
ggaaacctccccgctgccaccccgctctctgcttcaggggtaagaaaggcctggcatgaa
cacgtgactcagggcctgcgctcccatctggtgcacaaactagtacaagccatattcccg
accccagaccctgcagctctgaaggacaggcgaatggagaacttggtggcttacgcacgc
aaagttgagggagacatgtatgagtcagcaaacagcagggatgagtactaccacttcctg
gcagaaaaaatttacaagatccagaaagagctggaggagaagagacgctcgcgtctgcag
aaacagcccatcatggtgggcgctcccggaccccagcagcctggtatggctcagcccaac
agcatgggccctgcacaggccgttcgacctccaaatggacctgcaacaatgcccaacatg
ccaaatcagatgatgaaccgtatgcaggtggatcaaggaatcaatcagtttaacccaatg
gcgatgcagaatgcacagatgcctcaggcacccatgggagcgagggctccttccccaatg
agccatccgcagcagatgaacatgaattctgtgatgggcatgtctccatccaggatgccc
ccgaaccaaggcatgatgggtaatcatgctaatagcatgactcaaccagccacccaaggc
cagtacctgcagcagggtcagtatcctggtgctgcaggtggagccatgaatgtgaatata
ggcatgggtcagactatgccacaggctgccgttgcacagcaacaacaaacctctaacctc
cctctgaatgcactgggctcccagttgccctctggacccaccacccaacccacccggggc
accccccctccacccagcatcagccagcagcagcagcagcagcagcagcagcagcagcag
cagcagcagcagcagcagcagcatgctcccacacaggcccaggtgccgcagcagccctcc
actcctggctctgcagtaggacacccctctaccccaacccacattccaagtagccttcct
cgcccccctgcagctatgagcactccccctgacccctcccagcctctgacacccctgcag
cctccttctgagccccccagccagatgcagcagcccacctctgtgcagcctcagcaccct
agtacaccgttgtcccaggctgctgccggtattgataacagagtacccactcctggctct
gtggctgaactgagctccctgcaggctctgcctgacatgaccagctctgaggtcaaatcc
gaagtcaaagaggaagaagaagaggaggaggacagcaagtctggaaaaaagcaaaatgat
gtaaagatggaacaggacgatgaaaccaaaccctccctggtgaagaaggaggaaatggat
gcagcagaaccaaagcaggaacccatggagacggacgagaagaagccagaggtgaaggtg
gaacccaaagaagaggaggacggtgcgtccaccagcacatcagccacttccactgctcag
aaccgcaaaaaaattttcaagccagaggaactgagacaagcactgatgcccactcttgag
gccctctacagacaagaccccgagtccctacccttcaggcaacctgtagaccccatggtg
ctcggcattcctgactactttgacatagtgaagaaccccatcgacttatccaccatcaaa
cgcaagctggacacgggtcagtaccaggagccgtggcagtatgtggatgacatctggctc
atgttcaacaacgcctggctgtataaccgcaaaacgtcacgcgtctacaagtactgcacc
aagctggccgaggtgttcgaagcagagattgatcccgtcatgcaggttctgggctactgc
tgtggcaggaagtacgagttttcacctcagacgctttgttgctacggcaaacagttgtgt
accatctccagagacagcacctactacagctaccagaacaggtatcactattgtgagaag
tgcttcaatgagatccagggcaacagtgtgaacctgggggacgacccggcacaaccgcag
acgaaaatatctaaagatcagtttgaaaagaagaaaaatgatacgttggaccctgaaccg
tttgttgaatgtaaagactgtggaagaaaaatgcatcagatctgtgtgctgcactacgat
gtcatttggccctctggcttcgtttgtgacaattgcctgagaaaatcaggaaaaacaagg
aaggagaacaagttctcagcaaaaaggttgcagactacaaggttggggacgtacattgaa
gacagagtaaacaagtacttaaaaaggcagaaccacccagaagctggtgaagtgtttgtg
cgagttgttgccagctctgataaaactgtggatattaagcctggcatgaagtctaggttt
gtagactcaggtgagatgatggcgaacttcccttacagaaccaaagcactttttgcattc
gaggaaatcgatggcgtggacgtttgtttcttcggcatgcatgtacaggagtatggctca
gattgcccttttccaaacacaagacgggtttacatatcatacctcgacagtgttcacttc
ttcaagccacgtgtgctaaggactgcagtgtaccacgagatcttgataggctacctggag
tatgtgaggaaacttgggtatgtaatgggtcacatttgggcctgcccaccaagtgaagga
gatgattatattttccactgccaccctccggaccagaagatccctaaacccaaaaggctg
caggagtggtacaggaagatgcttgacaaggcgtttgcagagaggatcattcatgattac
aaggacattttcaagcaggcaacagaagacaggttgaccagtgccaacgagctgccatac
tttgagggcgacttttggcctaatgtgctggaggagagcatcaaggagctggagcaggag
gaggaggagagaaaaaaggaggagaacactgcctcctcggagacaacagagggagtccag
gctgacagcaagaatgccaaaaagaagaataataagaaaaccaacaagaacaagagcagc
gtcagccgatccaataagaagaagcctggcatgccaaatgtagccaatgatctgtctcaa
aaactctacgccaccatggagaaacacaaggaggtgttttttgtaattcacctccattcg
gggcctgtcatcaacaccctcccacctatcatggaccccgaccctctgctgacctgtgac
ctcatggacggacgtgacgccttcctgactttggccagggacaagcactgggagttcagc
tcgctcagaagatgcaagtggagctccatgtgcatgctggtggagctgcacaaccagggc
caggaccgctttgtctacacatgcaacgaatgcaagcatcatgtggagactcgctggcac
tgcactgtttgtgaggactatgacctgtgcattaactgctacaacactaagggccacgag
caccagatggtgaagtggggcctgggtatcgatgatgacagcaacagtcagagcggcgag
gcctcaaagagtcctcaggagagtcggcgcctcagcatccagcgctgcatccagtctctg
gtccacgcctgtcagtgcaggaacgccaactgctccctcgcgtcctgccagaagatgaag
cgggtggttcagcacactaagggctgcaagcgcaagaccaatggtggatgcccggtgtgc
aagcagctgattgctttatgctgttaccacgccaagcactgtcaggagaacaagtgtccg
gttccgttctgcctcaacatcaagcagaagcttcgtcagcagcagttgcagcacaggctg
cagcaggcccagatgatgcgccgcagaatggccaccatggctggaagaggtatgccgatg
ccatctccacctacctcagctgctccagaaacccccacgtctgtgcagcaacctaacacg
ccccagactccacaacccatgcctaaccaccctcagcaacagcaaccaccaccaaacccc
ggcaacatgggccaagggttccccagcaacggccgcagcagtcagccctccacgcctgtg
ccgcaaggtaaacctggcccacagtcatcgccgctccatcagcagctgtcccctatgcct
aacatgccgcatcagcagcaggctcctcctcctcagcagccgcagcaacagcagcagcag
ctgctggcagcaatgaaagtggcacaacagatcgagatggcggcaaaggcaaagcagcag
cagcagcagggttacgccatgaacgggatgcccatgaaccagtcacgcatgatgaacccc
attcagaaccaaatgcagatgatgccgggtccccggggtccccaggtgatgcaggctgtg
tcgcagggtcagtggggtgtgggaatgcagaatgcccaaggccatcagccactggtccct
cctcagcaaggccccatggcctcccaccaggctcagggaacccccatgtctcagcagtcc
ccactcatgcagaggcccgtgatgccacagcagtcgggtccccaaatgcctggggtcatg
cctcctcaggggcccccccaacagggaatgacatcgcagcagcagccaaacatgccccgg
gtaatgcctggaaatattacgccaagtgccgtgcaggaactactgcacaccctcaagtct
ccgagctccccacagcaacagcagcaggtgctgaccatccttaagtccaatccccacctc
atggccgctttcatcaaacagagagcggccaagtaccaggccagccaggcggtgccgcag
cagcagcagcaacagcagcagcaacaagtccagcagcagcaacaggtccagcagcagaac
cctcaggtcctgctgggctcccagcctgggatgcaggccatggcagctatgaaccaaatg
cagaggaccgggatggctccgcagcagcagcctcctcagctggtgggccctcagggtatg
ccccccatgggtcctcaaggccagatgatgaatacggctcaaaacggaaaccctcagtac
cacagacagctgctccgaatgcagcagatgcagcagcaggggggcatgcctcagggccac
agccagttccccacccagcagcaggggcccccaggcttctcccagctccgcgcgcatcag
cagatggctatgcaagggggctccggtccaatggggtcggttcctcccatgtcgcagatg
ggccagcccggcatgggtatggaagggatcccgaaccacctcaagcagcgcatgcttcag
catcagatgatgaagcagcagatgggttctcctgggcaggccaacccgatgagtcctcaa
cctcatctgctgcagggccaaggccagaccgcagctcatctatctggtcagaccatggct
aacaccctgggaaaccaggtccgctccccggctccggtgcagtcgccccggccgccttca
caacaagccccccattccggttcctccccgcggatacaaccccagccttcgccgcagcac
ggggctctccactccagctcccctcacccaagcctcggccccatgtcaggctctatggac
cagggacacatgggaacgcctgagcaaagcgcaatgctcccacagctgaacacaccaaac
cgaggagggctgagcaacgacatgaacatggtgggcgacacaacaggagacacgctagag
aggttcgttgaaggattgtag

DBGET integrated database retrieval system