KEGG   Xiphophorus maculatus (southern platyfish): 102230835Help
Entry
102230835         CDS       T02923                                 

Definition
NAD(P)(+)--arginine ADP-ribosyltransferase 1-like
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102230835
Cellular antigens [BR:xma04090]
 Proteins
  102230835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 275 aa AA seqDB search
MWMFLLVLFGESVSTAEIYRSHTDTPLPLDMAENSVDDMYEGCENKMATKVKTELLAREK
KMSKSFRLAWDEAATEYNKKWKPKPGKKKSQVLEKEQNMAIYAYTLDKPEIFTEFNNAVR
TQRAQYTSTFQYHSLHFFLTGALRALRALNARKPNTERCLTGYRRVNRTFELGVLGKEIR
FGAFTSSSMGKYPRKEKFGDETCFGIYTCLGADVSLYSKFGESEGEVLVPPYEIFKVTDI
KQRSENEELPCNVVLTLKSTEKILSNLNCALFKDN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtggatgttcctgcttgtgctgtttggagagtctgtctcaactgcagagatttacaga
tcccacactgatactccactcccattggacatggctgaaaactctgtcgatgacatgtac
gaaggctgcgagaacaagatggcgaccaaagtaaagacagagcttttggctagagagaaa
aagatgagcaaaagttttaggttggcttgggacgaagcggcgacagagtacaataagaaa
tggaagcccaagcctgggaagaaaaaatcccaagttctggagaaagaacaaaacatggcc
atctatgcttacactctggacaaaccagaaatattcactgaattcaacaacgcggtgcga
actcagagggctcagtacacgagcacgtttcagtatcactcactgcacttcttcctgacg
ggcgctctcagagctctcagagctctcaatgctcgtaagccaaacacagaaagatgcctt
accggttaccggagggtcaacagaacattcgagctgggcgttctcggcaaagaaatccgc
tttggcgctttcacctcgagctcgatgggaaagtatccccgcaaagaaaaatttggcgac
gagacttgtttcgggatttacacctgcttaggagcagacgtctcactgtactccaagttt
ggagaatcagagggagaagtcctggttcctccatatgaaatctttaaagttacagacata
aagcagagatctgagaacgaggagcttccatgtaacgttgtgttgacactgaagagcaca
gaaaagattctgtccaacctaaactgtgcacttttcaaggataactga

DBGET integrated database retrieval system