KEGG   Xiphophorus maculatus (southern platyfish): 102230835Help
Entry
102230835         CDS       T02923                                 

Definition
(RefSeq) NAD(P)(+)--arginine ADP-ribosyltransferase 1-like
  KO
K19977  ADP-ribosyltransferase 5 [EC:2.4.2.31]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102230835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ART ADPrib_exo_Tox
Motif
Other DBs
NCBI-GeneID: 102230835
NCBI-ProteinID: XP_005807946
Ensembl: ENSXMAG00000006520
Position
5
AA seq 283 aa AA seqDB search
MLKVETMTMWMFLLVLFGESVSTAEIYRSHTDTPLPLDMAENSVDDMYEGCENKMATKVK
TELLAREKKMSKSFRLAWDEAATEYNKKWKPKPGKKKSQVLEKEQNMAIYAYTLDKPEIF
TEFNNAVRTQRAQYTSTFQYHSLHFFLTGALRALRALNARKPNTERCLTGYRRVNRTFEL
GVLGKEIRFGAFTSSSMGKYPRKEKFGDETCFGIYTCLGADVSLYSKFGESEGEVLVPPY
EIFKVTDIKQRSENEELPCNVVLTLKSTEKILSNLNCALFKDN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggtggaaacaatgacaatgtggatgttcctgcttgtgctgtttggagagtct
gtctcaactgcagagatttacagatcccacactgatactccactcccattggacatggct
gaaaactctgtcgatgacatgtacgaaggctgcgagaacaagatggcgaccaaagtaaag
acagagcttttggctagagagaaaaagatgagcaaaagttttaggttggcttgggacgaa
gcggcgacagagtacaataagaaatggaagcccaagcctgggaagaaaaaatcccaagtt
ctggagaaagaacaaaacatggccatctatgcttacactctggacaaaccagaaatattc
actgaattcaacaacgcggtgcgaactcagagggctcagtacacgagcacgtttcagtat
cactcactgcacttcttcctgacgggcgctctcagagctctcagagctctcaatgctcgt
aagccaaacacagaaagatgccttaccggttaccggagggtcaacagaacattcgagctg
ggcgttctcggcaaagaaatccgctttggcgctttcacctcgagctcgatgggaaagtat
ccccgcaaagaaaaatttggcgacgagacttgtttcgggatttacacctgcttaggagca
gacgtctcactgtactccaagtttggagaatcagagggagaagtcctggttcctccatat
gaaatctttaaagttacagacataaagcagagatctgagaacgaggagcttccatgtaac
gttgtgttgacactgaagagcacagaaaagattctgtccaacctaaactgtgcacttttc
aaggataactga

DBGET integrated database retrieval system