KEGG   Xiphophorus maculatus (southern platyfish): 102230877Help
Entry
102230877         CDS       T02923                                 

Definition
protoporphyrinogen oxidase-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102230877
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102230877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 320 aa AA seqDB search
LADLAMDSVCRGVFAGDCKKLSVRSCFPWLYMAEQQRGSLTLGFLLGSGSAPVIVPGHLA
QRAKREAWAQWSLKRGVETLPESIAEFLQQSGKVELHRDAAVRQIIPTTSGWKVHVEDGV
ISADHIMSALPAKALSCILPPSCQGLVQQLQDISTVTVAVASLEYEGSILPVTGFGHLVP
SWEDPGLLGIVYDSVPFPQHNRQTGQTTRLTVMMGGAWFQNVFGAPQAVSADSLLARATE
AVRCHLGHCVAPSWSNVALHRDCIPQYHLGHFQRVDTMRAFIKNNNLLLSLIGSAYDGVS
VNDVIFSGRTAVAELLGSGV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttggcagacctagctatggacagtgtgtgtcggggtgtgtttgcgggggactgtaagaag
ctgagtgtgcgctcctgcttcccttggctctacatggctgagcagcagagaggttccctg
actctgggcttcctgctgggctcaggttcagcacctgtgattgttcctggacatctggct
cagagagcgaagagagaggcctgggctcagtggtctctaaagaggggagtggaaaccttg
ccagagtccatcgctgagttcctccaacagagcggcaaggtggagctgcacagggatgca
gctgttagacaaataattcccacaacatctggatggaaggtccatgtggaagatggtgta
atatcagctgatcacatcatgtctgctctaccagctaaagccctgtcctgcatcctgccc
ccctcctgccagggtcttgtccagcagctgcaggacatctcaacagtaactgtggctgtg
gccagtctggagtatgagggctccatcctcccagtaacgggtttcggccaccttgttcct
tcatgggaagacccaggtttacttgggatagtctatgattctgttccctttcctcagcac
aacagacagactggacagacaacaagactgacggtcatgatgggaggtgcctggttccag
aatgtgtttggggccccccaggctgtctcagcagacagcctcttagcgagggccaccgag
gcagtgcgctgccacttgggacactgtgtggcccccagctggagtaatgtggctcttcac
agggattgtatacctcagtatcacctcggacactttcagagagtagataccatgcgagcc
tttataaagaacaataacctactgctatctctgattggctcagcatatgatggcgtgtct
gtgaatgatgtcatcttcagtggacggacagctgtagcagagttgttgggaagtggagtt
tga

DBGET integrated database retrieval system