KEGG   Xiphophorus maculatus (southern platyfish): 102230877Help
Entry
102230877         CDS       T02923                                 

Gene name
ppox
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00860  Porphyrin and chlorophyll metabolism
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102230877 (ppox)
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     102230877 (ppox)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     102230877 (ppox)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Thi4 DAO NAD_binding_9 FAD_binding_2 Pyr_redox_2 MCRA
Motif
Other DBs
NCBI-GeneID: 102230877
NCBI-ProteinID: XP_023186375
Ensembl: ENSXMAG00000012837
Position
3
AA seq 476 aa AA seqDB search
MKTVAVLGGGIGGLAASFYLCKNPQVAKVIVLESSSRFGGWLWSLRRSDGAVFELGPRGI
RPAGAVGTNTLNMVEDLGLEGDILPVSYNHVASKNRYLYVNGQLHKLPSGISGILKTVPP
FSRPLLFSLLTEILVKKGREEDESIHSFVSRRLGKELADLAMDSVCRGVFAGDCKKLSVR
SCFPWLYMAEQQRGSLTLGFLLGSGSAPVIVPGHLAQRAKREAWAQWSLKRGVETLPESI
AEFLQQSGKVELHRDAAVRQIIPTTSGWKVHVEDGVISADHIMSALPAKALSCILPPSCQ
GLVQQLQDISTVTVAVASLEYEGSILPVTGFGHLVPSWEDPGLLGIVYDSVPFPQHNRQT
GQTTRLTVMMGGAWFQNVFGAPQAVSADSLLARATEAVRCHLGHCVAPSWSNVALHRDCI
PQYHLGHFQRVDTMRAFIKNNNLLLSLIGSAYDGVSVNDVIFSGRTAVAELLGSGV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtagcagtcctcggaggaggtatcgggggtttggctgcctctttctacctc
tgcaagaacccccaggttgccaaggtaatcgttctggagtccagcagtcgttttggtggt
tggctgtggtcactgaggcggtctgatggggccgtgtttgaactgggaccaagggggatc
cgacctgctggggcagtgggaaccaacacactcaatatggtggaagatctgggtctggaa
ggagatattcttccagtttcctacaatcatgttgcctctaagaaccgctatctgtatgtc
aatggacagctccacaagttgccttctggaataagtggaattttgaaaacagtccctcca
ttctcccgcccccttctgttcagtctcctcactgagatcttggtaaagaaaggaagagaa
gaggatgagtccattcattcatttgtctccaggaggcttggaaaggagttggcagaccta
gctatggacagtgtgtgtcggggtgtgtttgcgggggactgtaagaagctgagtgtgcgc
tcctgcttcccttggctctacatggctgagcagcagagaggttccctgactctgggcttc
ctgctgggctcaggttcagcacctgtgattgttcctggacatctggctcagagagcgaag
agagaggcctgggctcagtggtctctaaagaggggagtggaaaccttgccagagtccatc
gctgagttcctccaacagagcggcaaggtggagctgcacagggatgcagctgttagacaa
ataattcccacaacatctggatggaaggtccatgtggaagatggtgtaatatcagctgat
cacatcatgtctgctctaccagctaaagccctgtcctgcatcctgcccccctcctgccag
ggtcttgtccagcagctgcaggacatctcaacagtaactgtggctgtggccagtctggag
tatgagggctccatcctcccagtaacgggtttcggccaccttgttccttcatgggaagac
ccaggtttacttgggatagtctatgattctgttccctttcctcagcacaacagacagact
ggacagacaacaagactgacggtcatgatgggaggtgcctggttccagaatgtgtttggg
gccccccaggctgtctcagcagacagcctcttagcgagggccaccgaggcagtgcgctgc
cacttgggacactgtgtggcccccagctggagtaatgtggctcttcacagggattgtata
cctcagtatcacctcggacactttcagagagtagataccatgcgagcctttataaagaac
aataacctactgctatctctgattggctcagcatatgatggcgtgtctgtgaatgatgtc
atcttcagtggacggacagctgtagcagagttgttgggaagtggagtttga

DBGET integrated database retrieval system