KEGG   Xiphophorus maculatus (southern platyfish): 102231410Help
Entry
102231410         CDS       T02923                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102231410
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     102231410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 312 aa AA seqDB search
MSDRAFDVVVVGSCMTDLVSQAPRLPKAGETIHGHKFFIGFGGKGANQCIQAARLGVKTA
MICKVGKDFFGDNYIQNFKDNDVHTDFVWQTSDAATGAASITVNDAGENAIVIVAGANML
LGEEELQQALAAIRKAKVLVCQLEISLQTSLQALQMAHDNKVRTIFNPAPAVPDLDFSFY
RVSDVFCCNESEAELLTGYSVNNVEDAHHAAQELLRRGCTAVIITLGPQGCVVLKAQDKT
STHVPSTAVKAVDTTGAGDSFIGALAFYLAHHPDMPLEEMARRANQVAAVSVQAVGTQTS
FPFKQDLPANLF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagggcttttgatgttgttgtggtcggctcttgcatgactgacttggtgagc
caggcaccaaggctaccgaaagcaggagaaacaatccatggtcacaagttcttcattggc
tttggagggaaaggagccaaccagtgcattcaggcagctagactgggggtgaaaactgcc
atgatctgcaaggttgggaaagacttctttggagacaattatatccagaatttcaaggac
aatgatgtacacacagactttgtttggcagacttcagatgcagccacaggagccgcttca
atcaccgtcaacgatgcaggtgaaaatgccattgtaattgtggccggtgccaacatgctt
ttgggcgaagaggagctgcagcaagctcttgctgcaatcagaaaagctaaagtcttggtg
tgtcagctggagatcagtttgcagacttccctccaggctctgcaaatggctcatgacaat
aaagtaaggacgatcttcaacccagcgccggccgttcctgacttggatttcagtttctac
agggtctctgatgtgttttgctgtaatgagtccgaggcagagctgctgaccggctactcg
gtgaataatgtggaggatgctcatcatgccgctcaggagcttctgaggcgaggctgcacg
gcagtcatcatcactttgggaccccaaggctgtgtggtgcttaaggcacaggataaaact
tcgacacatgtaccatctactgcggtcaaagcagtggacacaacaggagctggcgacagc
ttcatcggagcactggcgttttacctggctcaccaccctgacatgcctctggaagagatg
gcacgcagagccaatcaggtggcagcggtgagcgtgcaggccgtcggcacccagacatca
ttcccgttcaaacaggacctgccagccaatttgttctga

DBGET integrated database retrieval system