KEGG   Xiphophorus maculatus (southern platyfish): 102231465Help
Entry
102231465         CDS       T02923                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102231465
  Amino acid metabolism
   00350 Tyrosine metabolism
    102231465
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102231465
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102231465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 264 aa AA seqDB search
MWLTLLYGCAGGAALLYALYRWVIPSVVQYHAGLALVWHDTIVEGLLNALTQTTRPQRML
AAVQKNATRGDPRSVVKAIDQFCRQKEWAMNVGDEKGCILDSVVTEVNPATVLELGTYCG
YSTVRIASLLPPDAKLITLEFNPHNAAIARQVIAWAGLGDKIQLVEGASGDWIPKMKEKF
GIETFDLVFLDHWKDRYLPDTKLMEECGLLRKGSILLADNVISPGTPDYLEYIRNSPRYK
SQYFRSHLEYTKAEDGLEKSVFLG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgactctcctctacggctgcgccggcggggccgctctgctgtacgcgctctac
agatgggtgatcccgtccgtcgtgcagtaccacgcgggtctcgcgctcgtttggcacgac
accatcgtggagggattgctgaacgccctgacccagaccacgcgtcctcagcgaatgttg
gctgcagtgcagaagaacgccactagaggggaccctcgcagcgtggtgaaagccatcgat
cagttctgcagacagaaggagtgggctatgaatgtgggagatgagaaagggtgcatcctg
gactccgtggtgactgaagtgaacccggcgacggtgctggagctgggaacctactgcggc
tactccaccgtgcgcatcgccagcctgctgccgcctgacgccaagctcatcaccctggag
ttcaacccacacaacgccgccatagctcgccaggtgatcgcttgggcaggattgggagac
aagatccagttagtggaaggggcatctggtgactggatccccaaaatgaaggagaagttt
gggatagaaacgtttgatttggttttcttggatcactggaaagatcgctaccttcccgac
acaaagctgatggaggagtgcggtctcctcaggaaaggcagcatcctattggcagataac
gtcatctccccaggaacgcccgactacctggagtacattcgcaacagcccccggtataaa
agccagtacttcagatctcacctggagtacaccaaagcggaagatggtttggagaaatcg
gttttcttagggtag

DBGET integrated database retrieval system