KEGG   Xiphophorus maculatus (southern platyfish): 102231965Help
Entry
102231965         CDS       T02923                                 

Definition
neuroendocrine convertase 2-like
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     102231965
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S8: subtilisin family
   102231965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 642 aa AA seqDB search
MCGNSRCGTAVGFMVLLNALLIFATQATEGVLTDHLLVQLHEDAQDEAHQVATQHGLQSA
RKLPFGDGLFHFYPQETSKRRSKRSTRIKQSLQKDRRVKKVFEQEGFSRQKRGYRNINDI
EVNMSDPLFTKQWYLINTGQADGTPGLDLNVAEAWALGYTGKGVTIAIMDDGIDYLHPDL
ASNYNADASYDFSSNDPFPFPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAG
IRMLDQPFMTDIIEASSISHMPQEIDIYSASWGPTDDGKTVDGPRELTLQAMADGVNKGR
GGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSN
GRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANPNLTWRDMQHLSVLTS
KRNQLHDEVHQWRRNGVGLEFNHLFGYGVLDAGGMVKMANEWKTVPERFHCVAGSIQEVH
KFQSGNKLVLAITTEACQGKDNFVRYLEHVQAVVTVNATRRGDLNINMTSPMGTKSILLS
RRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEVGFRGDQPQRGVLKEWTLMLHGTQSA
PYIDQIVRDYQSKLAMSKKEELEEELDEAVERSLKSLMSKNN
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaaattcccgctgtgggacagccgtgggatttatggtactgctgaacgcgttg
ctgatatttgcgacgcaggctacagaaggagtcctgacggaccaccttttggttcagttg
catgaggacgcgcaggatgaggcgcaccaagttgcaacacaacatgggctccagagtgca
cggaagcttccctttggagatggcctgtttcacttctatcctcaggagacttcaaagagg
cgaagcaaacgcagcactcgtatcaaacagagcctccaaaaagacagaagggtaaagaaa
gtcttcgaacaggaaggtttcagtcgtcagaagcgaggctacagaaatatcaatgatatt
gaagtgaacatgagtgaccctctgttcaccaagcagtggtacctgataaacacagggcag
gcagatgggacccccgggttggatctaaatgtggctgaagcttgggcactggggtacaca
ggcaaaggagtcaccatcgcaatcatggatgatggtatcgactacctacatccagacctg
gcatcaaattataatgccgatgccagctacgattttagcagcaacgacccgtttccattt
ccacgatacacagatgactggttcaacagtcatggcacacgatgtgctggggaggtctct
gcggcagccaacaataacatctgtggtgtgggagtcgcctacaactccaaggtggcaggc
atcaggatgctggaccaaccttttatgactgatatcattgaagcatcatctatcagccac
atgcctcaagaaattgacatatacagtgccagctggggaccgactgatgatggcaagact
gtggatggaccgcgagaacttacattgcaggctatggctgatggtgtcaataaggggcgt
ggaggaaaaggaagcatctatgtatgggcgtcaggcgatggcggtagctatgacgactgc
aactgtgacggctacgcctccagcatgtggaccatctccatcaactctgcgatcaacgat
ggccgcaccgctctgtatgatgaaagctgctcctccacgctggcgtccacattcagtaac
gggcgaaaacgcaacccggaggctggtgttgctactacagatctgtatggaaactgcact
ctgcgtcactctggaacatcagcagcagcaccggaggcagcaggtgtctttgctctggct
cttgaagctaaccctaacctgacatggagagacatgcagcacctgtcagtcctgacgtcg
aagcgaaaccagctccatgacgaagtccaccagtggagaaggaacggtgtgggtttggag
ttcaaccacctgtttgggtatggcgtgctggatgctggggggatggtgaaaatggccaac
gaatggaaaacggttccagagcgtttccactgtgtagctgggtccatccaggaagtccat
aaattccagtctggcaataagctggtgctagccattaccactgaggcctgtcaggggaag
gacaactttgtccgctacctggagcatgtccaggctgtagtcactgtcaacgccacccgc
cgtggagacctcaacatcaacatgacctcaccgatgggcacaaagtccatactgttgagt
cgaaggccccgggatgacgactccaaggtcggctttgacaagtggcccttcatgaccacc
catacctggggggaggacccccgtggcacctgggtcctggaggtgggttttcggggcgat
cagcctcagcggggggtcctcaaggagtggactctcatgctgcatggaacacaaagtgcc
ccttacatagaccagattgttcgtgattatcagtccaaacttgccatgtccaaaaaggag
gagctggaggaggagctagatgaggccgtagagagaagtctgaagagcttgatgagtaaa
aacaactga

DBGET integrated database retrieval system