KEGG   Xiphophorus maculatus (southern platyfish): 102231986Help
Entry
102231986         CDS       T02923                                 

Definition
chymotrypsin A-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102231986
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102231986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 263 aa AA seqDB search
MAFLWILSCLAFVGAAYGCGSPAITPVITGYARIVNGEEAVPHSWPWQVSLQDYTGFHFC
GGSLINENWVVTAAHCTIRTSDRVVLGEHDRSSNAESIQVISPGQVFRHPQYNSFTINND
ITLIKLSSPAQLNMRVSPVCLAESSDNFPGGMMCVTSGWGLTRYNAPSTPALLQQAALPL
LTNANCSNYWGSNITDLMICAGAAGASSCMGDSGGPLVCEKSGAWTLVGIVSWGSSTCST
STPAVYARVTELRAWVDQTIAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctgtggatcctctcctgcctcgccttcgtcggcgccgcctacggttgcggc
tcacctgccatcactcccgtcatcaccggttacgcccgcattgtgaacggtgaggaggct
gtgcctcactcctggccctggcaggtgtctcttcaggactacactggcttccacttctgc
ggaggctctctcatcaacgagaactgggtggtgacggctgctcactgcactatcaggacc
agcgaccgcgtggtcctcggagagcacgaccgctcctccaacgcagagagcatccaggtg
atttctcccggccaggtgttcagacacccccagtacaacagcttcaccatcaataacgac
atcaccctgatcaagctgtccagccccgcccagctcaacatgcgggtttcccccgtgtgc
ctggctgagtcctccgataacttccctggaggcatgatgtgtgtgacctctggctggggt
ctgacccgctacaacgcccccagcacccccgctctgctgcagcaggccgctctgcccctc
ctcaccaatgctaactgcagcaattactggggcagcaacatcaccgacctgatgatctgc
gccggagcggccggagcctcctcctgcatgggtgactctggaggtcctctggtctgtgag
aagagcggagcctggactctggtgggcatcgtgtcctggggcagcagcacctgcagcacc
agcactccggctgtctacgcccgcgtcaccgagctgcgcgcctgggtcgaccagaccatc
gctgccaactga

DBGET integrated database retrieval system