KEGG   Xiphophorus maculatus (southern platyfish): 102232214Help
Entry
102232214         CDS       T02923                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102232214
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102232214
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102232214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 860 aa AA seqDB search
MTSEWGEKSTADLMSRCVSKEMGQGVPKEGWRICLAHEFKEKRKPFQAKDVSLSNVMDHI
GLGIRYLKWWYKKTQVEKKAPFIDMFRALPLRQIYGAPLGGIGGGTITRGWRGEFCRWQL
NPGMYHYKTVIANQFTVCLRRGGQTVYQQVLSVERPPTLQGWNWGYCGEYAFYHALYPRA
WTVYQLPGQNVTLTCRQISPVIPHDYQDSSLPAAVFVWDIENKNDYALDVSIMFTMVNGS
GHKDDKSGGHWNEPFHLEKDGEAVSGVLLHHCTAANPYTLCIAAREQADREVSHQTAFSP
KGTCSGLWSDLITDGRLDSPTGSSPPTQKGEKVAAALAVSCSVPAHKLNSLEFCLAWDMP
RITFGSREREHVRRYARYFGDKGDASPSLSHYALTHYKQWEKSIEEWQRPILRDSSLPPW
YKSALFNELYFVADGGTVWTELSEDADVSGGVRSEDGGLPAQPALVKEYGRFAYLEGQEY
RMYNTYDVHFYASFALIMLWPKLALSVQYDIAGTVVQQDPTERLHLMNGRYSPVKTKNVV
PHDIGDPDDEPWQRLNAYLIHDTADWKDLNLKFVLQVYRDFHLTQDSQYLQDMWPICQAV
MESELKFDQDGDGLIENSGYADQTYDGWTVTGASAYCGGMWLASLCVMCKMARLVDSEEA
YQRYKDLLERGSAAFDKLLWNGKYYNYDSSERALSNSVMSDQCAGHWFLRASGLEEEAYQ
AFPKEKIRRALKSVFDLNVMSFSEGHMGAVNGMRPEGVPDRSSVQSDEVWIGVVYGLAAT
MIHEGMLEEGMRTAEGCYRTVWERLGMAFQTPEAYCERSIYRSLAYMRPLSVWAMQLALD
RSQRDNTVRAKTGDTDEIET
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggagtggggcgagaagtccacagcggacctcatgagcagatgcgtctctaag
gaaatgggacaaggggtgcccaaagaggggtggcggatctgtctggcgcacgaattcaag
gagaagaggaagccctttcaggccaaagatgtctcgctgtccaatgttatggatcacatc
ggcctgggaatcaggtatctcaaatggtggtacaagaagactcaagtggagaagaaggct
ccattcatcgatatgtttcgagctctgcctctacggcaaatatatggtgctcctctcggc
ggtatcggaggcggcaccattacaagaggttggaggggggagttctgcagatggcaacta
aaccctgggatgtaccactacaaaaccgtcatagccaaccagttcactgtgtgtttgcgc
cgcggaggacaaacggtttaccagcaggttctgtccgtggagcgtccgcccacgctgcaa
ggctggaactggggctactgcggagagtacgccttctatcacgccttgtacccccgcgct
tggaccgtgtaccagctgccgggtcagaacgtcaccctcacctgtcggcagatatccccc
gtcatccctcatgactaccaggactcgagtctcccagcggcagtatttgtgtgggacata
gagaacaagaatgactacgctctggatgtctccatcatgtttacaatggtcaacgggtcg
ggacacaaggacgacaagagcggcggccactggaatgagccgttccacctggagaaggac
ggggaggcggtgtccggagtcctgctgcaccactgcaccgcagcgaacccctacaccctg
tgcatcgcagcgcgagagcaggctgacagggaggtgagccatcagacggccttcagtcca
aaaggaacctgcagcggtttgtggagcgacttgatcactgacggacgactggactccccc
acagggtccagcccaccaacccagaagggagagaaggtagcagctgcgttggcggtgagc
tgctcggtgccggctcataagctcaacagcctggagttctgcctggcctgggacatgccc
agaatcaccttcgggtccagggagagggaacacgtcaggagatatgctcgttactttggg
gataaaggggatgcatctccgtccctcagccattacgcactgacacactacaaacaatgg
gagaaatccattgaggagtggcagagacccatattacgggacagttctcttccgccttgg
tacaagtccgctctgtttaacgagctgtacttcgtggcggacggaggaaccgtgtggacg
gagctttcggaggacgctgacgtcagcggcggtgtgcgcagtgaggacggcggtctgcca
gctcagcctgctctcgtcaaggagtacggccgatttgcttacctagaaggtcaagaatac
agaatgtataacacgtacgacgtgcacttctacgcctccttcgcacttatcatgctgtgg
cccaagctagccttgagtgtgcaatatgatattgctggcaccgtggttcagcaggatcca
acagagaggctgcatctgatgaacggccgttactctcctgtcaagacaaaaaacgtggtg
cctcatgacataggagacccagatgatgagccttggcagaggttaaacgcttacctcatc
cacgacaccgcagactggaaggacctgaacctgaagtttgtcctgcaggtctacagggac
tttcatctgacccaggacagtcagtacctgcaggacatgtggcccatctgccaggctgtg
atggagtctgagttgaagtttgaccaggacggagacggcctgatagaaaactcgggatat
gcagatcagacgtatgatggctggactgtgactggagcgagtgcgtactgtggtgggatg
tggctggcgtccctgtgtgtgatgtgtaaaatggccagactggtggacagtgaagaggct
taccagcgttacaaggacctcctggagagaggcagtgcagcctttgataaactcttatgg
aacggaaagtattacaattatgacagcagcgagagggcactttctaacagcgtcatgtct
gaccagtgtgccggacactggttcctcagagcatctgggctggaagaagaagcctatcag
gcatttcccaaagaaaagatccggcgcgcactgaaatctgtctttgatttgaatgtaatg
agcttctctgaaggccacatgggcgccgttaacggcatgcgtcctgagggagtgcccgac
cgctccagtgtccagtcagatgaggtctggatcggagttgtgtacgggctggcagctact
atgattcatgagggtatgttggaggaaggtatgcggactgcagagggttgctaccgaaca
gtatgggagcggctgggaatggccttccagactcctgaagcttactgcgagaggagcatc
taccgctctctggcctacatgaggcctcttagtgtttgggccatgcagctcgctctggac
aggtcccagagggacaacactgttcgagctaaaaccggagacaccgacgagatcgaaacc
tga

DBGET integrated database retrieval system