KEGG   Xiphophorus maculatus (southern platyfish): 102232442Help
Entry
102232442         CDS       T02923                                 

Definition
bifunctional protein NCOAT-like
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102232442
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     102232442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 919 aa AA seqDB search
MVQKDKTLDTPPLDVEPSPSPVSGEACVEAPGPVADSSIVVETTGHRKFISGVVEGFYGR
PWTMEQRKELFRRQQKWGLNTYLYAPKDDYKHRMFWRELYSVEEAEQLMTLVSAAKEHGI
EFIYAISPGLDITFSNQKEVSALKRKLDQVTHFGCKSFALLFDDIDHNMCPADKEVFSSF
AHAQVSLTNEIYQYLGEPETFLFCPTEYCGTFCYPSVSQSPYLRTVGEKLLPSIDVLWTG
PKVVSKDIPVESIEEVSKILRRAPVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVL
TNPNCEFESNFVPIHTLATWYKSNMNGVRKDVVMTDGEDSTVSIQIKLENEGSDEELETD
MLYSPQLALKLALTEWLAEFSVPLQYNSRQVPQSGAKSTAIDVSSMTAPSLCSSTSVTTV
FQQPIMSPAMPPLLLDPLPHSFSKTVEEVEEVDVEKKDSDEEPMEMVVEKLDEQEAEADP
EEKDVAPILTYKMAEDLKPMDTDKESLAESKSPEESIQEDSGSDIAPMQTDDQLKQDPYV
PSPIEKPLFTPEPPTLEDLCLLAELFYLPYEHGPKATQMLKEFNWLRANSSVVSVNCKRK
ESEKVAEWQLRAEKFQDMCCSVIHMFTRLSNTANRTILFDLYPYIWDIKSMMSMVKSFVL
WLGCRSQSSAQFPKGEQESWAFRGGLAGEFQRLLPIDGANDLFYQPPPSLPTSKIYTIRP
YYPKDEASVYKICKEMYCEGMEDEPFTEGEPDLIGDRLVGGLLTVSSDYGFVLEDDQGIC
GYALGTVDVKPFIKKCKSSWIPFMQEKYHKPDCEKDLSEAEKMILSFHEEEEGLPESFLS
NFPSLIKVDIHAKVTDPSVAKSMMGCLLSSLKANGSHGAFCKVRQTDKRMLEFYSKLGCF
EVAKMDGFPKDVIIMGRSL
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggttcaaaaagacaagactttagacactcctccgttagatgttgaaccgagccccagc
ccagtctctggagaggcttgtgtggaggccccgggcccagtggcggactccagcatcgta
gtggaaacgacgggccacagaaaattcattagtggtgtagtcgaaggcttttacgggcgt
ccatggactatggaacagagaaaagagctgttcagaaggcaacagaagtgggggctgaac
acatatctttatgcacctaaagatgactacaagcacagaatgttctggagagaactgtat
tcagtggaagaagcagaacaactcatgactttagttagtgctgccaaggagcatggaata
gagtttatatatgccatttcccctggattagacataacgttctctaatcagaaagaggtt
tctgcacttaaaagaaaacttgatcaggttactcattttggctgcaaatcctttgcctta
ctttttgacgatattgaccacaacatgtgccctgctgacaaagaagtattcagctctttt
gctcatgctcaggtttctctaactaatgaaatctaccagtaccttggagagcctgaaacc
ttcttgttttgccccacagagtactgtggaacattctgctacccaagtgtctcgcaatcc
ccctacctccgcacagttggagagaaactcctgcctagcattgatgtgctgtggacaggt
cccaaagtagtttctaaagacatcccagtggagtccattgaagaggtgtcaaagatcctg
agaagagcccctgttatttgggacaatattcatgccaatgattacgaccaaaagaggctc
tttttaggtccgtacaagggccgttccactgagctcatcccccggctgaagggagtcctc
accaaccccaactgcgagtttgaatccaattttgtcccaattcacactttggccacctgg
tacaagtctaacatgaacggggttcgcaaagatgtggtcatgactgacggtgaggacagc
actgtgtccatccagatcaagcttgagaatgaaggcagtgatgaggagctggagacagac
atgctctacagcccacagctcgctttaaagctcgctctgacagagtggcttgcagaattc
agtgtgcctctccaatacaacagccgacaggtgcctcagagtggtgccaaaagcacggcc
attgatgtatcttccatgacagctccgtccctttgctcctccacgtcagtcactactgtg
ttccagcagcccattatgtctcctgcaatgccccctctcctcctcgatcccctcccacac
tccttttcaaaaacagttgaagaggtagaagaggtggatgtggaaaagaaggattcagat
gaggagccaatggagatggtggtagagaagctggatgagcaagaggcagaagccgatcca
gaagagaaagacgtcgctcccatcttgacttacaaaatggcagaggacctgaagcccatg
gatacagacaaggagagtctggctgaatccaagtccccagaagagtcaatccaggaggat
tctgggagtgatattgctcctatgcagacagatgatcaactcaaacaggatccgtatgtg
cccagccccatcgagaagcctctgttcacaccagaacctccaacactcgaggacctgtgt
ctcctggctgagctcttttacctgccttacgaacatggacccaaggccacacagatgcta
aaggagttcaactggttgagagccaacagcagcgtcgtcagcgtcaactgtaagagaaaa
gaaagtgaaaaggtggctgaatggcagctgcgggcggagaagtttcaagacatgtgctgc
tccgttatccacatgttcacacggctgtccaacacagccaaccgcaccatcctgttcgac
ctctacccttacatctgggacatcaagagcatgatgtctatggtcaagtcttttgtcctg
tggctcgggtgtcgtagtcagtcctcagcacaattccctaaaggagaacaagagtcctgg
gcctttaggggaggtctagcaggagagttccagagattgttgccaatagatggggcaaac
gatcttttctaccagcctccaccttctttgccaacctccaaaatctataccataaggcca
tactatcccaaagatgaggcttcagtttacaaaatctgtaaggaaatgtactgcgaaggg
atggaagatgagccattcactgagggggaacctgacctcattggggacaggctagttgga
ggactgctgacagtgagctcagactatgggttcgtactggaagatgaccaggggatctgt
ggttacgctctcggcactgtagatgtgaagcctttcatcaagaagtgcaagtcgagctgg
attcccttcatgcaggagaaataccacaaaccagactgtgaaaaggatctgtctgaggcc
gagaagatgattctgagttttcatgaggaggaggagggtctaccggagtctttcctgtcc
aatttcccatctctcatcaaggtggacattcacgccaaagtcactgaccccagtgtggcc
aaaagcatgatgggatgtttgttatcttctcttaaggccaatggttcccatggtgctttc
tgtaaagttcgtcagactgataaacgaatgttggagttctacagtaaactgggatgtttt
gaagtggccaaaatggacggctttcccaaagatgtcatcattatgggacgcagcctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system