KEGG   Xiphophorus maculatus (southern platyfish): 102232560Help
Entry
102232560         CDS       T02923                                 

Definition
mitochondrial 10-formyltetrahydrofolate dehydrogenase-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102232560
Enzymes [BR:xma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     102232560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 923 aa AA seqDB search
MLWTATRVLRKFSTSSHYYQNKLKLAIIGQSLFGQEVYSNLRKQGHKVVGVFTVPDKDGK
ADPLAVAAEKDGTPVFKFTRWRVKGQPIPDVVDAYKSVGAELNVMPFCSQFIPMNVIDHP
RHGSIIYHPSILPLHRGASAINWTLIHGDKKAGFSVFWADDGLDTGPILLQRECSVEPND
TVDTLYNRFLFPEGIKAMVEAVQLIADGKAPRIPQTEEGASYEGIQKKSNSRVDWAQPAE
AIHNWIRGHDKVPGAWTVIDGQPVTLYGSSMLGGSVPAGQALEIEGASQPSLVTKSGLVL
YGTDGNALLVKNLQFEDGKMIPASKYFSSGESSSVELTDDEKKMAEEIKNIWKGILSNVG
TIEETTDFFKSGAASMDVVRLVEEVKQKCAGVQLQNEDVYMATTFHNFIQMFVRKLRGED
QEEELVVDYATRDVNNMTVNMPYQCFIDGKFEDAENSKSYDTINPTDGSVICKVSYASVA
DVDRAVAAAKEAFDSGPWGRMNPRDRGSLLYKLADLMEEHQEELATIESIDSGAVYTLAL
KTHVGMSIQTFRYFAGWCDKIQGKTIPINQARPNRNLTFTKKEPLGVCAIVIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGIPKGVINILPGSGGMVGQRLSD
HPDIRKLGFTGSTPIGKQIMKSCALSNLKKVSLELGGKSPLIIFSDCDMDKAVRMGMSSV
FFNKGENCIAAGRLFVEESIHDEYISRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLDKLL
EYCETGVKEGATLVYGGKQVGRPGFFMEPTVFTDVEDHMFIAKEESFGPVMVVSKFKDGD
VDGVLQRANDTEYGLASGVFTQDISKAMYVSERLEAGTVFVNTYNKTDVASPFGGFKQSG
FGKDLGEDALLEYLKTKAVTVEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggacagcgactcgagtcttaaggaaattctccacctcctcccattactaccag
aataagctaaaactggccattattggtcagagtctgtttggccaagaggtgtacagtaac
ctgaggaagcagggtcacaaggttgtgggtgtgttcacagttcctgacaaagatggcaag
gccgaccccctggctgtggcagcagagaaggacgggacgcccgtgtttaaatttacgagg
tggcgcgtcaaagggcagcctatcccagacgtggtggacgcgtacaagtcggtgggcgca
gagctcaacgtcatgcccttctgctcccagttcatccccatgaacgtaatcgaccatccc
cggcacggctccatcatctaccacccgtccatcttaccgctgcacagaggagcttctgcc
atcaactggacccttattcacggtgacaaaaaagctggcttcagcgtgttctgggccgac
gacggcctggacacgggccccatcctgctgcagagggaatgcagtgtggagcccaacgac
acggtggacacgctgtacaaccgcttcctcttcccagagggcatcaaagccatggtggag
gcggtgcagctcatcgctgatggaaaggcgcctcgaatcccccagacagaggaaggagcg
agttatgagggcatccagaagaagtccaactccagggtggactgggcccagccagctgag
gccatccacaactggatccgcggccatgacaaagtccccggagcgtggaccgtcatcgat
ggtcagcctgtgaccctttatggctcgtccatgttgggggggtcggtacctgccggtcag
gccttggaaattgagggggcctcccaacccagcctcgtcaccaagtccgggctggttctg
tatggaaccgacgggaacgccctcctagtcaagaatctgcagtttgaagacggaaagatg
attcctgcttccaagtatttctcctcaggagaaagctccagcgtggagctgaccgacgac
gagaagaagatggccgaggaaatcaagaacatctggaagggaatcctcagcaatgtgggc
accatcgaggaaacgacagacttcttcaagtccggagccgcttccatggatgttgttagg
ttagtggaggaggtcaagcagaagtgtgcaggcgtccagctgcaaaacgaggacgtgtac
atggccaccaccttccacaacttcatccagatgtttgtccgcaagctccgaggggaggac
caggaggaggagctggtcgtcgactacgcaaccagagatgtgaacaacatgacggtgaac
atgccgtaccagtgcttcatcgacggaaagtttgaggatgcagaaaatagcaagagctac
gacaccattaatccaaccgatggatctgtgatctgtaaggtgtcgtatgcatcagtggca
gatgtggaccgggccgtggctgctgctaaagaagcttttgattctgggccatggggcagg
atgaaccccagagacagaggaagtctgctctataagcttgccgacctgatggaggaacac
caggaggagctggccactattgagtccattgactcaggagccgtttacacgctcgccctg
aagacacacgtgggcatgtccattcagaccttccgctactttgcaggctggtgtgacaaa
atccagggcaagacaatccccatcaaccaagccagacccaaccggaacctgaccttcacc
aagaaagaacctctgggagtttgtgccatagttattccatggaactaccctctgatgatg
ctggcctggaagagcgcagcctgtctggcagctggaaacacactggtccttaaacctgct
caggtaactcctctgaccgctctgaagtttgctgagctttctgtgaaagccggaatccca
aaaggagtcatcaatattctgccaggctcaggcggcatggtgggtcagagactctctgac
cacccggacatccgcaagctgggcttcaccggctccactccaatcggcaaacagatcatg
aagagctgtgcgctcagcaacctgaagaaagtttctctggagctggggggaaaatctccc
ctcatcatcttcagcgactgcgacatggacaaggcggttcgcatgggcatgagctcagtg
tttttcaacaaaggggagaactgcattgctgctggacgcctgtttgtggaggagtccatc
catgatgagtacatcagccgagtggtagaggagatcaagaagatgaagattggagaccct
ctggaccgctccacagaccacggtccccaaaaccacaaagctcacctggacaaactgctg
gagtactgcgagacaggagtgaaggaaggagccacactggtgtatggaggcaaacaagtt
ggcaggccaggtttcttcatggaacccactgtgttcactgatgtagaggaccacatgttc
attgctaaagaggagtcctttggtcctgtcatggttgtgtccaaattcaaagatggcgat
gtggacggtgtgcttcagagagccaatgacacagagtatggcctggcctcaggcgtgttc
acacaggacatcagcaaagccatgtatgtcagcgagcgactggaggctggaaccgtgttc
gtaaacacctacaacaagaccgatgtcgcctcgccttttggaggcttcaagcagtcaggc
ttcggcaaagacctcggagaggacgccctcttggaatacctcaaaaccaaagcagtgact
gtggagtactga

DBGET integrated database retrieval system