KEGG   Xiphophorus maculatus (southern platyfish): 102232849Help
Entry
102232849         CDS       T02923                                 

Definition
eukaryotic elongation factor 2 kinase-like
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     102232849
Protein kinases [BR:xma01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   102232849
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 707 aa AA seqDB search
MDDDLMFSMEEEGSAQRPSAQRNGIKHRAHSLGNANASDDDEDEEHFISPILCDSAKEVC
NYLKDLVYTRQLSNSLPKSNFLYRAAWINAIEKARAMPDPWAQFHLEDIETEPCVRYRYS
AITGEWAQDQIHVKMGAQPFGKGAMRECFRAKKLSNFSHSSNWKSASNYVAKRYMETVDR
EVYFEDVRLQMEAKLWGEEYNRHRPPKQVDIMQMCVVEMTNRPGKPLFHLEHYIEGKYIK
YNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDG
NLGVRGMALFFHSHLCNKICKSMGLTPFDLSEPEASQLDCTNKLLKSAKTVLRGCEEVCG
SPRVRTFSASRVPPLLSRLSEPSSADESASDMDSIPCSPLALPFSPIVAPGSMGKSSSGT
FLNLFCFPGKSIHYLSGDSESGGDSGYPSERRSEGDPNDHVDGLTDEKWSFFHSSRAHVH
RPSCVATEVERLNALLQKKIGQSILGKVHLAMVRYHEAGRFCEKDEQWDQDAAMFHLERA
ALCGELEAIVALGKCYLQLPHHILPDMEVEDNAGNRMKGFKYLLQAAEAGDRSSMIVVAR
AFDTGAGLSADRSRDWAEAIHWYDSALNMMDYDEGGEFDGTQDEPRYSLLAREAEMFQEG
GFNLTADPQKAGDLFTEAAEAAMAAMKGRLANQYYMKAEEAWALVEE
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgacctgatgttcagcatggaggaggagggcagcgcccagagaccctccgct
cagagaaacggcatcaaacaccgggctcactcgctcggcaacgccaacgccagcgacgac
gatgaagacgaggaacacttcatctcgcctatcctgtgcgactctgctaaagaagtctgc
aactacctgaaagatctggtttacacacggcagctatcaaactcacttccaaagagcaac
ttcctatacagggcggcatggataaacgccatagagaaggcccgagccatgcccgacccc
tgggcgcagttccacctggaggacatcgaaactgaaccctgcgttcgttacaggtacagc
gcgatcacaggagaatgggctcaagaccagatccacgtcaagatgggggcacagcccttt
gggaaaggagccatgagggagtgtttcagagccaagaagttgtccaacttctcacacagc
agcaactggaagtcggcgtccaactatgttgccaagcgctacatggagaccgtggacaga
gaggtttactttgaggacgtccggctgcagatggaggccaaactttggggggaggagtac
aaccgccacagacctcccaaacaggtggacatcatgcagatgtgcgtggtggagatgacg
aacagaccgggaaaaccgctcttccacctggagcattacatcgaagggaagtacatcaag
tacaactccaactcgggcttcgtgagggacgacaacatccgactgactccacaggccttc
agtcacttcaccttcgagcgctcgggccaccagctgatcgtggtcgacatccagggagtc
ggcgatctctacacagaccctcagatccacacagagaaggggacggatttcggagatgga
aatctcggtgtgcggggcatggctctgttcttccattcccacctgtgcaacaagatctgc
aagagcatgggcctgacgcctttcgatctttctgagccagaggcgtcccagctggactgc
accaacaaacttctgaagtcggccaagacggtcctgaggggctgcgaggaggtctgcggc
tcgcctcgcgtccgcaccttttccgccagccgcgtccctccgctgctgtcccgtctgtcc
gagccctcttctgcggacgagagcgcgagtgacatggactccatcccctgctcgcctctc
gccctccccttctctcccatagtggcacctggatccatgggcaaatcctcttcaggtaca
ttcctaaaccttttttgtttccccggcaaaagcatccattacctaagtggagactcggag
agcggcggagacagcggctacccgagcgagaggaggagtgaaggggatcctaatgatcat
gtagacgggctgacggatgagaagtggagcttcttccactcgtctcgggcccacgtccac
cgaccttcctgcgtggccaccgaggtggagcgcctgaacgctctgctgcagaagaagatc
gggcagtcgatcctgggaaaggtccacctggccatggtgcgctaccacgaagcgggccgg
ttctgtgagaaggacgagcagtgggaccaggacgcggccatgttccacctggagagagcc
gccctgtgcggagagctggaggccatcgtagccttaggaaaatgttacctgcagctgcct
catcacattctcccagacatggaggtggaggataacgcaggaaacaggatgaaggggttt
aagtatctgctccaggctgctgaggcgggagacagatcttctatgatcgttgtggccaga
gccttcgatacgggagccggtctgtctgctgacaggtcacgggactgggctgaagcgatc
cactggtacgacagcgccctgaacatgatggactacgatgagggcggggagttcgatggc
acgcaggacgagccgagatactcgctgctggccagagaggcggagatgttccaagagggc
ggcttcaaccttactgcagatccacagaaagcaggggatttgtttacggaagccgcagag
gctgcgatggcggccatgaaaggtcgcctggccaaccagtactacatgaaagccgaagag
gcctgggcactggtggaggagtaa

DBGET integrated database retrieval system