KEGG   Xiphophorus maculatus (southern platyfish): 102233340Help
Entry
102233340         CDS       T02923                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102233340
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     102233340
Glycosyltransferases [BR:xma01003]
 Glycan extension
  Type 3 chain
   102233340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 257 aa AA seqDB search
MTGPRNLESRTKHVKQTWGKHCHHILYMSSVKTDFPTVELNVSEGRENLYWKTIRALQYI
HQHHQDQANWFLKADDDTFVVIENLQYILSKLDPEKPLYLGRRFKPFISQGYMSGGAGYV
LSKEALRRFVEGFQTGQCTHFSTIEDMALGKCMETMKVEPVDTRDVKGRQTFHAFPLDHY
VIRQLPRPRPWHMIYDYYEPNEGPNCCSDFIVSFHYIYAVQQYVLEYFTYHLRPYGYSYR
FWPDEIVEANNKTNKGG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacccaggaacctggaatcacggaccaaacatgtcaagcaaacatggggcaag
cattgccaccacattctgtacatgagttcagtgaagacagacttcccaactgtggagctg
aacgtgagtgaagggagggaaaacctgtactggaagaccatcagagcactccagtacatc
caccagcaccatcaggaccaagccaactggttcctgaaagccgatgatgatacgtttgtg
gtcatagagaacctgcagtacatcttatccaagcttgacccagaaaaacctttgtacctt
ggtcgaaggtttaagcctttcatcagccaaggctacatgagtggaggagcaggttacgtc
ctgagcaaagaagcactgaggagattcgtcgaagggtttcaaacaggacagtgtactcac
ttctccacaatagaagacatggctctggggaaatgtatggagacgatgaaggtggagcca
gtggacaccagggacgtgaagggcaggcaaacattccacgcttttcctctagaccattac
gtcatacgacaactaccaagacctcggccgtggcatatgatctacgactactatgagcca
aatgagggtccaaactgctgctcagattttattgtatcttttcactacatttatgctgtt
cagcagtatgtgctggagtattttacctaccatctgcgaccctatggatactcatataga
ttctggcctgatgaaatagtggaagcaaacaacaaaaccaataaaggaggatga

DBGET integrated database retrieval system