KEGG   Xiphophorus maculatus (southern platyfish): 102233516Help
Entry
102233516         CDS       T02923                                 

Definition
glycogen [starch] synthase, muscle-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102233516
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102233516
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102233516
Glycosyltransferases [BR:xma01003]
 Polysaccharide
  Storage polysaccharide
   102233516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 645 aa AA seqDB search
MPLARSLSVTSLSGLDEWDEEFELEDAVLFEIAWEVANKVGGIYTVIQTKARMTAEEWGE
NYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNASGCKYAAQSEDPPHIVAQFHEWLA
GLGLVLCRQRQLAVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYHRYCL
ERAAAHCAHVFTTVSQITAIEAEFLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRI
QEFVRGHFYGNLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDVTVIT
FFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKMLDKED
FTIMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCVRRIGLFNSSADRVKIIFHPEFLSS
TSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIAD
PSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRYLGRY
YIAARHMALAKAFPDTYVYDPQEPSSASGFRYPRPASVPPSPALSRHSSPHHSEGEDNEE
DERYDEELEAEKDRVNIRQPYTISVKGKTVLGGNGSGEDEASEKN
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcgcagcctgtctgtcacgtccctatcaggacttgacgagtgggacgag
gagtttgagttggaggatgctgtactttttgaaattgcttgggaggtagccaacaaagtt
ggagggatctacacagtcatacagaccaaagcccgtatgaccgcagaggaatggggggag
aactatttcctggtgggtccctacgtggagagcaacgtgcgcacccaagtggagctgatc
gagccaaccaatcctgtgctgaagcggaccattgataaaatgaacgccagtggctgtaag
tatgcggctcagtctgaggatcctccacacattgtagcccagttccatgagtggctggca
ggtctgggcctggtgctgtgcagacagagacagcttgctgttgcaactattttcaccacc
catgctacactgctgggtcgctacctgtgtgccggaaatgtggacttctacaacaacctg
gcagagttcaatgtggataaagaagccggagatcggcaaatttaccatcgctactgtctg
gagcgggcagctgcacactgcgctcacgtcttcaccactgtgtcacaaattacagccatc
gaggccgagttcctgctcaagaggaaacccgacatcgtcactccaaatggtctcaatgtg
aagaagttctctgctatgcatgagtttcaaaacctccacgctcagagcaagagtcgcatt
caggagtttgtcaggggtcacttctatgggaaccttgacttcaacctggacaagtgtctg
ttcctcttcatagcaggaaggtatgaattctccaacaaaggagccgacatcttcctcgag
gctttagccagactcaactatctgctgagagttaaccacagcgatgtgaccgttataact
ttcttcatcatgccagctcggaccaacaacttcaacgtggagacgctgaagggccaagca
gtgcggaagcagctatgggatacagcccagactgtaaaggagcgctttggaaagaaactt
tatgaatcactcctagttggtcagctgccagatgtgtcgaagatgctggacaaagaagac
ttcaccatcatgaagcgtgctatctttgcgactcagaggcagtgccagcctccagtctgc
acccataacatgctggaggacagcagcgaccccatccttaactgcgtccgccgcatcggc
ctcttcaacagctctgctgaccgagtcaagatcatcttccacccagagttcctttcatcc
acgtctcctctgcttcccatggattacgaggagtttgtcagaggctgccaccttggtgtc
ttcccttcttactatgagccttggggttatacaccagctgagtgcacagtgatgggtatt
ccatccatatccactaatctgtcaggcttcggatgtttcatggaggaacacatagcagat
ccttcagcgtacggtatttacatccttgaccggcgctacaagggtgtcgacgagtcgtgc
aaccagctcacttccttccttttccagttctgcaaacagagccgacgccagcggatcatc
cagaggaatcgcacagagcgcctgagtgacctcctggactggagatacctcggcagatat
tacatagctgctcgtcatatggccttggctaaagccttcccagacacctacgtatatgac
cctcaagagccctcctcggcttcgggtttccgctaccctcgaccagcctctgtgcctccg
tctccggctctgtcccgtcactcctccccgcaccacagcgagggcgaagacaacgaagag
gatgagcgttacgacgaggagcttgaggccgaaaaggaccgcgtgaacatccgccagccc
tacaccatatcggttaaaggcaaaaccgtcctcggaggcaacgggagcggcgaggacgag
gcgagcgagaaaaactga

DBGET integrated database retrieval system