KEGG   Xiphophorus maculatus (southern platyfish): 102233947Help
Entry
102233947         CDS       T02923                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L1-like
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102233947
Peptidases [BR:xma01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102233947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 220 aa AA seqDB search
MEWTAMEINPEMLNKIMRKLGVSGRWRFVDILGLEGEQLTAVPKPSCALMLLFPLTQQHE
AFRTQQANKISGGSDVYFLKQVASNSCGTIALVHAIANNKAKMTFENGSVLKTFLDETAG
MSPDERSKHLEGNKVICEAHNEVAREGQCRPEGEQVNFHFIAFVNVNGQLYEFDGKMNGP
VNHGATKDETFVTDAAKVCRSFMEREKDEVRFSAVALCQS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggagtggactgcgatggaaatcaaccccgagatgctgaacaagattatgcgcaagctc
ggtgtgagtggacgctggcgtttcgtggatattttgggtctggagggtgagcagctaacc
gccgtcccgaagccatcctgtgccctgatgctgctcttccccctgacgcaacagcatgag
gcgttcaggacccagcaggcgaacaagatttcaggaggttctgacgtctacttcctgaag
caggtcgcctctaattcctgtggcacaatcgccctggtgcacgccatcgccaacaataag
gccaaaatgactttcgagaacggctcagtcctgaagacctttctagatgagacggctggc
atgtctccagatgagcgttccaaacatctggagggaaacaaggtaatctgtgaggctcac
aatgaggttgcaagagagggacaatgtcggccagaaggtgaacaagtaaacttccacttt
atcgcctttgtgaatgtgaacggacaactctatgaatttgatgggaagatgaacggacca
gtgaaccatggagcaaccaaagatgagacctttgtcactgatgcagccaaagtgtgccgc
agcttcatggaacgagagaaagatgaagtccgcttctcggctgtggctctctgtcagtct
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system