KEGG   Xiphophorus maculatus (southern platyfish): 102233952Help
Entry
102233952         CDS       T02923                                 

Gene name
gba
Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00511  Other glycan degradation
xma00600  Sphingolipid metabolism
xma01100  Metabolic pathways
xma04142  Lysosome
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102233952 (gba)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102233952 (gba)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102233952 (gba)
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     102233952 (gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 102233952
NCBI-ProteinID: XP_005810346
Ensembl: ENSXMAG00000016183
UniProt: M4AP41
Position
3
AA seq 522 aa AA seqDB search
MVLLLPSALVVALVVSAADVTLCAGINRCVARNLGHDSVVCECNSTYCDGVGPVSLPPLG
QYSTYLSSMAGSRMEPGHGQVQVNSTGAGLRLTIVPYQKYQRIKGFGGAMTDAAAINILS
LSAGAQEQLLRQYFSKEGIGYSVVRVPMASCDFSTRLYTYADTPGDYNLKSFALAPEDVK
MKIPLLLRAQALSPVPLSLLGSAWSAPAWMKTNGALIGKGSLKGQPGGKEHKTWAQYYIR
FLEEYAKYNLTFWALTTGNEPSAGQMTSYSFQALGFTPEEQRDWVAMDLGPALQSSAHPH
THILILDDNRLLLPHWARVVLSDVHAARYIHGVAVHWYLDSFVPAEASLGATHQLFPEYY
LFGTEACAGWSSADRGVKLGSWDRAEQYAHDILEDLNHYVVGWTDWNLALDQTGGPNWVK
NFVDSPVIVDAKRDVFYKQPTFYSMAHFSAFLWEGSQRVGVSASGKTQLEFSAFVRPDGS
VVLIVLNRSPSAIQFEVWDPAVGYIPCTAQAHSLLTVAWNTH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgctgttgccatcagctcttgtcgtagctcttgttgtcagtgcagcagacgtg
actctttgcgcaggaatcaacagatgtgttgccagaaacctcggccatgactctgtggtg
tgtgagtgtaattccacctactgtgacggtgttggtccggttagcctgccacctctgggt
cagtactccacctacctgagcagcatggcaggcagcaggatggagccaggccacggtcaa
gtccaggtcaacagcactggagcaggtctcaggctgacgattgttccctaccagaagtac
cagaggatcaaggggttcggaggagccatgacggacgcagcggctattaacatactttct
ctctctgctggcgcacaggagcagctgctgcgacagtacttctccaaagaaggtattggc
tatagcgttgtgcgcgtccccatggccagctgtgacttctccactcggctgtacacttac
gctgacacacccggggactacaacctgaaaagcttcgctttggcccctgaggatgtgaag
atgaagatccctctgctgctgcgtgcccaggccttgtcccctgtcccactgtccctgctg
ggcagtgcctggagcgcccctgcctggatgaaaactaatggtgcactcataggaaagggc
tccctgaagggccagccagggggcaaggagcataaaacatgggctcagtactatatcagg
ttccttgaggaatatgctaaatataacctaaccttctgggcgctgactacaggaaatgag
ccctctgcaggacaaatgacaagctacagtttccaggctctgggcttcactcctgaggag
cagagagactgggtggctatggacttgggcccggccctgcagtcctcagcacacccacac
acacacatcctcatactggatgacaaccgcctgctgctgccccactgggcccgagtggtt
ctcagtgatgttcatgcagcacgatacattcacggcgtggcggtgcactggtacctggac
agtttcgtccctgcagaggcgagcctgggagccacccatcagctgttcccagagtactat
ctgtttggcacggaggcctgtgcgggctggagctcagcggaccgcggggtgaagctgggc
agctgggaccgggcagagcagtacgcacatgacatcctagaggacttaaatcactacgtt
gtgggctggactgactggaacctggcactggaccagactggtgggccaaactgggtgaag
aactttgtggacagccccgtcatagtggacgccaagcgggacgtcttttacaaacagcca
actttctacagcatggcccactttagtgctttcctgtgggaggggtcccagagagtggga
gtgtctgctagtggaaagacacagcttgagttctccgccttcgtcagaccagacggctct
gtggttctcatcgttctcaacaggtcaccatcagccattcagtttgaggtgtgggatccg
gctgtgggttatattccctgcactgcgcaggcccattctctgctcacggtggcttggaac
acacactga

DBGET integrated database retrieval system