KEGG   Xiphophorus maculatus (southern platyfish): 102234375Help
Entry
102234375         CDS       T02923                                 

Definition
creatine kinase M-type-like
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    102234375
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     102234375
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   102234375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 381 aa AA seqDB search
MPFGNTHNNFKLNYKVEEEFPDLSKHNNHMAKVLNKDIYAKLRDKQTPSGYTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYEVFKELLDPIISDRHGGYKPTDKHKTDLNFENLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHNSRGERRAIEKLAVEALTSLDGEFKGKYYPLKSMT
DAEQEQLISDHFLFDKPVSPLLTCAGMARDWPDARGIWHNDDKTFLVWVNEEDHLRVISM
QKGGNMREVFRRFCVGLQKIEEIFKKHNHGFMWNEHLGYILTCPSNLGTGLRGGVHVKLP
KLSTHPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVDQVQLVVDGVKLM
VEMEKKLEKGEAIDGMIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcggaaacacccacaacaacttcaaactcaactacaaagttgaggaggagttc
ccagacctgtccaagcacaacaaccacatggccaaggttctgaacaaggacatatatgcc
aagttgagggacaagcagacaccaagcggttacactttggatgatgtgatccagactggt
gtcgacaaccctggtcaccccttcatcatgactgttggctgcgtcgctggtgacgaggag
tcctatgaggtttttaaggagcttcttgaccctatcatctccgaccgtcatggtggatac
aagcccactgacaagcacaagactgacctcaactttgagaacctgaagggtggtgatgac
ctggaccccaactatgtcctgtccagccgtgtccgtactggtcgcagcatcaagggatac
accctgcctccccacaacagccgtggcgagcgtagagctattgagaagctggctgttgag
gctctcaccagcctggacggtgagttcaagggaaagtactatcccctgaagtccatgact
gacgccgagcaggagcagctgatcagcgatcacttcctgtttgacaagcccgtctctccc
ctgctgacctgcgctggcatggcccgcgactggcccgacgccagaggcatctggcacaat
gacgacaagaccttcttggtctgggtaaacgaggaggatcacctgcgtgtcatctccatg
cagaagggtggcaacatgagggaggtcttcaggcgtttctgcgttggcctgcagaagatt
gaggagatcttcaagaaacacaaccatggtttcatgtggaacgagcatctcggctacatc
ctgacctgcccctccaacctgggtaccggcctgcgtggtggcgtccacgtcaagctgccc
aagctgagcacacatcctaaatttgaggagatcctcacaaggctgcgcctgcagaagcgt
ggcacaggcggtgtggacactgcatctgtgggtggcgtgtttgacatctccaatgctgac
cgtctgggctcctctgaggtggatcaggtccagctggtggttgacggtgtcaagctcatg
gttgagatggagaagaagctcgagaagggagaggccattgacggcatgatccccgcccag
aagtaa

DBGET integrated database retrieval system