KEGG   Xiphophorus maculatus (southern platyfish): 102235031Help
Entry
102235031         CDS       T02923                                 

Gene name
abhd12b
Definition
(RefSeq) abhydrolase domain containing 12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102235031 (abhd12b)
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102235031 (abhd12b)
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102235031 (abhd12b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 325 aa AA seqDB search
MKKVLSFLLTAYVSVPVLLYLFPWILSYAIFSHLLRLPYSVDLRRPQDVLNHTCNFYLSP
EEGVSVGVWHTLPASQWEAAAGRNLDWYQEALGDGRPVIIYLHGNVGTRAISHRVELVKI
LSAAGYHVLSLDYRGFGDSSGEPSEAGLTNDALYLHQWAKARSRGIICLWGHSLGSGVAT
NAAVKIQEQGSAVDALILEAPYTRIGEVVANNRLAKLYMFLPGFESLLWNILERINISFS
NDKNLQTLSSPLLILHAEDDKVVPFHMGQKLYQISLRAQRESETGDRVQMISYGANLGLS
HSRICSAPDLAGVVQKFLQNLERER
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagttctgtccttcctgctgactgcgtacgtctcggtgcctgttcttctctac
ctgtttccctggatactgagctatgccattttctctcatctgctgaggcttccatactcg
gtggatctccgcagacctcaggatgtcctgaaccacacctgcaacttctacctcagccca
gaggagggcgtctcggtgggagtgtggcacacgctccctgccagccaatgggaggcggcc
gctgggaggaatctcgactggtaccaggaggccctgggagacgggcgtcctgttattatc
tacctccatggcaacgtagggaccagggcgatcagtcatagagtggagctggtgaagatc
ctgagtgctgcaggataccacgtcttatctttagactacagaggatttggagattcttcc
ggagagcccagcgaggctgggttgaccaacgacgccctctacctgcaccagtgggcaaag
gcacggagcagagggataatctgcctgtggggacactctctgggctctggagtggcaacc
aacgctgcagtgaaaatccaagaacaaggttctgccgtcgacgctctgatcctggaagct
ccgtacacgagaattggagaagtcgtagcaaataaccggctggccaagctgtacatgttc
ctgccgggtttcgagagtttgctctggaacattctggaaaggatcaacatttcattttcc
aatgataaaaatttgcagacgctgagcagccccctcctgatcctgcatgcggaggacgac
aaggtcgttccgtttcacatgggtcagaagctgtaccagatatcgctgcgagcccagagg
gaatccgagacgggcgatcgagtgcagatgatctcctacggggcgaacctcggactgtcc
cacagccgcatctgctcggcccccgacttggcaggcgtcgtgcagaaatttctacagaac
ttggagagagaaagatga

DBGET integrated database retrieval system