KEGG   Xiphophorus maculatus (southern platyfish): 102235463Help
Entry
102235463         CDS       T02923                                 

Definition
lysozyme C-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102235463
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102235463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 146 aa AA seqDB search
MKMTKTLVLLLLVAAANAKVFERCAWARTLKANGMDGYHGISLADWVCLTQHESNFNTNV
KYRNTDGSTDYGIFQINSRWWCRDGGVSTSNGCGINCSQLLTDDVRKAITCAKRVVRDPN
GVGAWVAWRRHCQNRDLSSYLRGCRL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgacgaagaccctggtgctgctgctgctggtggctgcggccaacgctaaagtc
tttgagcgctgtgcgtgggcgcgcaccttgaaggccaatggcatggatggttaccatggc
atcagcctggccgactgggtttgcctgacccaacacgagtcaaacttcaacaccaacgtc
aaataccgcaacacagacggctccaccgactacggcatcttccagatcaacagccgctgg
tggtgcagagatggcggagtctcaacatccaacggatgcggcatcaactgcagccaactc
ctgacagacgatgtgagaaaggcgatcacctgcgccaaacgcgtcgtcagggatcccaat
ggcgtcggagcatgggtggcctggcgtcgtcattgtcagaaccgagacctgagcagctac
ctgaggggctgcagactctaa

DBGET integrated database retrieval system