KEGG   Xiphophorus maculatus (southern platyfish): 102235592Help
Entry
102235592         CDS       T02923                                 

Definition
histone acetyltransferase p300-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    102235592
   04330 Notch signaling pathway
    102235592
   04350 TGF-beta signaling pathway
    102235592
   04630 Jak-STAT signaling pathway
    102235592
   04068 FoxO signaling pathway
    102235592
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102235592
  Cellular commiunity
   04520 Adherens junction
    102235592
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    102235592
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102235592
Enzymes [BR:xma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102235592
Transcription factors [BR:xma03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    102235592
Mitochondrial biogenesis [BR:xma03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102235592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 2522 aa AA seqDB search
MADNVLESGPPSAKRPKLASPALSVSTSDGNDFGSFFDLEHDLPDELISSSDPGLTNGGD
SSQFHTSLGGLGGGVQDAASKHKQLSELLRAGAPTQPGAPTTNSAPSAASMAMMGGVGGP
QGMHHQGQQQQPQPGLMQQVGMVPNRATAMMGVQKGTAGQQQHQHQHQGLIGGQVVNGSP
RMGYPGNTGMGSNSNILAETLQQQGSPALGAGGQAGMRPHQPGALKQMNLLANAGNYGGP
YSHSAGQGLPGEGLGPQLQNKAGLPSGMAAQFNMDKKTPPVGGVSASVGGPQVGLNTVGV
GPGATPPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTH
CQAGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQSLLNSVSLVNSLGG
AGPGGQSSSPSLNPTNQIDPSSIERAYAALGLTYQGNQMPQQQQQQQQQPPQGAMPNQVL
HGQPGMRTLNPLGGNSIGVNGAVGVQPPNQQSALLPDAMLHSMNAQSLMNDSVGNLGSMP
TATPPSAAGMRKSWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEG
DMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQGMMPGQPCLPTSGLPQGPPGMG
QPPGPPGPPGQPPNGPHPDPSMIRPAGPNQMVNRMQNPPGMTQFPQMGMQNMGQRSTPPL
PHNPQMNQMGMGATRMGQPGAPQLQTQYLPPGQFPGSSPGLGSGPVGMNQPGVQAAVPSQ
NQMSTPPSIPASSPAAQSASSVPCSGGSFGPSNGNGPGPLANLHPPSTQSSPFPHCPPVR
TNSPSPVRSLTPQPHQTPPTLPRSQTPQPQTPNTPQHTIGGVASPEPPAAQIPSVPTQND
HVPPLPHTPPSPKTSLTAEGQVSSPASITSSSAHNSQLASAESLAQSQDNIKVKVEKEEE
EEEEEEEDNVGGDTEGNSKGKMYKAQSEVKKEEKPEDEKPRGDACKAEPMDTSTSSGSLA
AAASSEDKKPEVKKEPKEEEQGSGSPATNSSSASSQSKKKMFKPEELRQALMPTLEALYR
QDPESLPFRQPVDPPLLGIPDYFDIVKNPMDLSTIKRKLDTGQYEEPWQYIEDIWLMFNN
AWLYNRKTSRVYKYCSKLAEVFESEIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTIQR
DASYFSYQNRYHFCEKCFNEIQGDSVSLGDDPSQPQASINKDQFQKKKNDTLDPELLVEC
IDCGRKMHQICVLHNETIWPSGFVCDNCLKKANKTRKENKYAAKRLPQTKLGNYLETRVN
DYLKRQSHPESGEVSVRVVHVSDKVVEVKPGMKSRFVDNGEMAESFPYRMKALFAFEDID
GADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFKPRHLRTAVYHEILLGYLEYVKR
LGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVAERIVHDYKDIF
KQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREESSTSNESTDATKGDSK
NAKKKNNKKANKNKSSLSRANKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLIAGPTA
NSLPPITDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRSMWSSMCMLVELHNQSQDRF
VYTCNECKHHVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDDSNNQAAAATQN
PGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLI
ALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMATMQRVGQPAGAPP
GGLMVGLPSPGTNSATAPSTPTSVGTQPPTPHTPTQNMPPVPAQGMGPGNGMQQQQQGAM
PTQHPLNQFQQMSGGAAAAGGMMNSPQQQQQMLTQMQQQSIPGGNPHPPYSGRPPGSSPI
HQSQGKPLIGSSTPPQQPGGAVMPGNAAGQQQPPGQPPPSGPPPAAVEIALKIQQVADAQ
RRLGLQRQAAAVAAATGMMPSHPHHQPGQPQQMAMGHGGPVGMVGPQGMQPQNQTAVRAH
MDQQQGAMQGMMAAGGHMQQQPPPQGNLPPQRMGAPLQNPQQPQQQWTGPGIPPQQRQAM
MNQMSHQAMMAAHSPLQQQQVLNILRSNPQLLAAFIKQRASKYKGGPGGADGVPGGSPGP
AGGPVGHAMPGVNPQVNMNAASSQPGMHMGGQGGANVNMASMSQLQQGQGFMGQGPPGAP
QGQQAQGYPGSAQQQRLQLQLQQQQQQQNSMAALQSGDAGPGGGGVAQQPPQGPQPPQGG
PTPPSSQTLFQQTLPQRLLQQQQQQHLGPGSSPAQHSNPMSPQQPPQQMAPSPHHHLQGQ
ALPTSLANQVRSPQPSPRPQSQPPHSSPSPRMQPQPSPHHISPQVQTGSPHPGHLNQHHP
GMVVPAPQQQQQTSQQQNAMEQFGSDQSAMLSQLSSMAGLHGPAGGPDPMGQNMNHNSLD
HM
NT seq 7569 nt NT seq  +upstreamnt  +downstreamnt
atggccgataatgtcctggagtctggcccgccttcagccaagaggcccaagctggcttct
ccagctctgtctgtgtccaccagtgatggaaatgattttggttcattctttgacctggag
cacgacctgccggacgagctcatcagttcctcggacccggggctgacgaacggaggagac
tccagccagttccacaccagcctcggggggctcggcggaggggttcaggatgcggcctcc
aaacacaaacagctatctgaactgctgcgcgctggggcaccaacgcagccaggggccccc
actaccaacagtgccccctccgcggcttccatggcgatgatggggggagtcggtggacct
caaggcatgcaccatcagggccaacagcagcagccgcaacctggactaatgcagcaggtt
ggcatggtgccgaacagggcgacggccatgatgggtgtccaaaagggcactgctggacag
caacagcaccaacaccaacaccaagggcttataggggggcaggttgtgaatggctcgccc
agaatgggttaccctggcaacacaggaatgggtagcaatagtaatattttggcagagacc
ttacagcagcagggcagtccagccctgggagctgggggtcaagcggggatgagaccacat
caacctggtgcactgaaacagatgaatttgttggccaacgcgggaaactacggtggccca
tacagccattctgctggccaggggctgcctggagaggggctgggcccacaactccagaat
aaagcaggcctacccagtggtatggccgcccagttcaacatggacaagaagacacctcct
gttggcggcgtgtcggcatcggtcggtgggccccaggttggactgaacaccgtcggggtg
ggtccgggcgccacgccccccaccgccgaccccgagaagcggaagctcatccaacagcag
ctcgtcctgttgctccacgcgcacaagtgccagcggcgggagcaggccaacggggaggtg
cggcaatgcaacctgccccactgccgcaccatgaagaatgtgctcaaccacatgactcat
tgccaggctggcaagtcctgccaggttgcacactgtgcctcgtccagacagatcatctcg
cattggaagaactgcacgagacacgactgtcccgtgtgcctgccgctgaaaaacgccgga
gacaagaggaaccagcagtctctgctcaacagtgtaagcttagtgaactctttaggcgga
gcggggccaggcgggcagtcgagctctccgagcctgaaccctaccaaccagatcgatccg
agctccatagagagagcctacgctgcattaggcctgacgtaccagggcaaccagatgccg
cagcaacagcagcagcagcagcaacagccgccacagggtgccatgccgaaccaagtcctt
cacggacagccgggaatgaggactctgaatccactgggtggtaactccataggagtgaac
ggcgccgtcggggtgcagcctccgaaccagcagtctgcgctgctgccggatgccatgctg
cacagcatgaacgcgcaaagtttgatgaacgacagtgtcgggaacctgggctccatgccc
acggccacgcccccttccgctgcagggatgaggaagtcttggcatgaagacatcacgcaa
gacctccgcaaccacctcgtccacaagctagtgcaagctatcttccccactcccgacccc
gcggcgctgaaggacaggcggatggagaacttggtggcctacgctcggaaagtagaggga
gacatgtacgagtcggcgaacagcagggcggagtactaccaccttctggcggagaagatc
tacaagatccagaaggagctggaggagaagaggaggacgcggctccaaaagcagggcatg
atgcccggccagccctgccttcccacgtctggcctcccacagggtccgcctggcatgggc
cagcccccggggcccccagggccacccggacagcctcccaatggtcctcatcccgacccg
tccatgatcagacctgctggtccaaatcagatggtcaacaggatgcagaacccaccagga
atgactcagtttcctcagatggggatgcagaatatgggtcagaggtcaacgcctcctctt
cctcacaaccctcaaatgaaccagatgggaatgggagcaacacgtatgggtcagcccggt
gccccacagcttcagacccagtaccttcccccaggccagtttcctggctccagtcccggt
ctcggttctggtcctgttgggatgaaccagcctggagtgcaggctgcggtgccttctcag
aaccagatgtcgacgcctccatccatccctgccagcagccccgcggcgcagtccgcctcc
tcggtcccgtgctccgggggatcttttggtccctccaacggcaacggtcccggaccgctg
gccaacctccacccaccctccacccagtcctccccattccctcactgcccgcccgtccgc
acaaactccccgtccccggtgcgcagcttgacgccccagccgcatcagacgccacctacg
ctgccccgctctcagacgcctcagccacagaccccaaacacaccgcaacatacaattggg
ggtgttgcatctccggagcccccggcagctcagattccctcggtcccgacccagaacgat
catgtgccaccgctgccgcacaccccaccctctcctaagacttccctgacagctgaagga
caagtttcgtccccggcgtcaattacaagcagctccgcccacaattcccagctcgcttcc
gcagagagcctggctcagagccaggacaacatcaaagtaaaggtggaaaaggaagaagaa
gaagaggaggaggaggaggaagataatgtagggggcgacactgagggaaacagcaagggg
aagatgtacaaggctcagtctgaggtgaagaaagaagagaaaccagaggacgagaagccg
cgaggagacgcgtgtaaagctgagcccatggacacgtcaacgtcgtctgggtcgttggcg
gcagcagcctcgagcgaagacaagaaaccggaggtgaagaaggagcccaaagaggaagag
cagggatcagggtcaccagccaccaacagctcctcagccagcagtcagagcaagaagaaa
atgtttaagccggaggagctgcgccaggccttgatgccgaccttggaggcattataccgc
caggaccctgagtcccttcccttccgccagccggtggaccccccgttactgggaataccc
gactacttcgacatcgtcaagaaccccatggacctctcaaccattaagcgcaagttggac
acggggcagtatgaggagccgtggcagtacatcgaggacatctggctgatgttcaacaac
gcctggctgtacaaccgaaagacgtcacgggtctacaagtactgctccaagctggccgag
gtgtttgagtcggagatcgaccctgttatgcaggggctgggctactgctgtgggaggaag
tacgagttttctccccaaactctttgctgctacggaaaacaattatgcaccatccaacgc
gatgcttcttactttagttaccagaacaggtaccacttctgtgagaagtgtttcaacgaa
atccaaggcgacagcgtgtccctgggggacgacccctcccagcctcaggcgtccatcaac
aaagaccagttccagaaaaagaagaacgacacgctcgaccctgagctcctcgtggaatgt
atcgactgcggtcgtaaaatgcaccagatctgcgttctgcataatgaaaccatatggccg
tcaggcttcgtatgcgacaactgtctgaaaaaggccaataagacgcgaaaggagaacaaa
tatgcagccaaaagacttcctcagacgaagctggggaactacctggagacgcgagtgaac
gactacctcaaacggcagagccaccccgagtctggagaggtgagcgtccgggtggtccat
gtctcggacaaggtggtcgaggtcaagccgggcatgaagtccaggtttgtggacaacggc
gagatggccgagtcgtttccgtacaggatgaaggccctgttcgcattcgaggacatcgat
ggagccgacgtgtgtttcttcggcatgcacgtccaagagtacggctccgactgcccgccg
ccgaaccagagacgggtgtacatctcttacctggacagcgtgcacttttttaaaccgcga
cacctgaggaccgccgtctaccacgagatcctgctgggctacctggagtacgtcaagaga
ctggggtatacgacgggacacatttgggcgtgtcctcccagcgagggagacgactacatc
ttccactgtcacccgccggaccagaagatcccgaagccaaaacgcctgcaggagtggtac
aagaagatgttggacaaggctgtcgctgagcgaatcgtccacgactacaaggacattttc
aagcaggcgacagaggaccgcctgacgagtgccaaggagctgccgtacttcgagggcgac
ttctggcccaacgtgctggaggagagcatcaaggagctggagcaggaagaggaggagagg
aagcgggaggagagcagcacctccaacgagagcacagacgccacaaaaggagacagcaag
aacgccaaaaagaagaacaataaaaaggcgaacaagaacaagagcagcctgagccgagcc
aacaagaagaagccggggatgcccagcgtttccaacgacctttcccagaaactctacgcc
accatggagaaacacaaagaggttttcttcgtcatccgcctgatcgccggccccaccgcc
aactcgctgccccccatcaccgaccccgaccccctcatggcctgcgacttgatggacggc
cgtgacgccttcctcaccctggcccgcgacaagcacttggagttcagttccctgaggagg
tccatgtggagctccatgtgcatgctggtggagctccacaaccagagccaggaccgcttc
gtgtacacctgcaacgagtgcaaacatcacgtggagacccgcttccactgcaccgtttgt
gaggattatgacttgtgcatcacctgctacaacactaaaggccacgagcacaagatggac
aaactggggctcggcctggacgacgacagcaacaaccaggcggcggcggccactcagaat
ccgggcgactcccgccgcctcagcattcagcgctgcatccagtcgctggtccacgcgtgc
cagtgccgcaacgccaactgctccctcccgtcctgtcagaagatgaagcgcgtcgtgcag
cacaccaagggctgcaagcgcaagaccaacggtggctgccccatctgcaagcagctgatc
gcgctgtgctgctaccatgccaagcactgccaggagaacaaatgccctgtcccgttctgc
ctgaacatcaagcagaagctccggcagcagcagctgcagcaccggctgcagcaggcacag
atgttgaggaggaggatggccaccatgcagcgggtgggtcagcctgcgggtgcgccaccc
gggggactcatggtggggctgccatcgccaggaaccaacagcgccacggcgcccagtacg
cccacgtcggtcggcacccagccgccgaccccccacaccccgactcagaacatgcccccg
gtcccggcgcagggcatgggtcctggaaacgggatgcagcagcagcagcaaggagcgatg
ccgacccaacatccgctgaaccagttccagcagatgagcggcggagcggctgcagcagga
gggatgatgaactctccccagcagcagcagcaaatgcttactcagatgcagcagcaaagc
atcccggggggcaacccccacccgccgtactccggcagaccgccaggctcctcccccatc
caccagtcccaggggaaaccattgattggttcgtcgacgccgcctcagcaacccggtggg
gctgtgatgcccggcaacgcggcggggcagcagcagcctcctggccagccgcccccgtcc
ggccccccaccagcagctgtggagattgccctgaagatccagcaggtggccgacgcccaa
aggaggctgggcctgcagaggcaagccgcggcggtagcagcggcaacgggcatgatgccg
tctcacccacaccaccagccgggtcagccccagcagatggccatggggcacggcggtccc
gtagggatggtcggaccacaggggatgcagccgcaaaaccaaacggctgtaagagcccac
atggatcagcagcagggtgcgatgcaggggatgatggcagcaggcgggcacatgcagcag
caacccccgccgcagggtaacctgccaccacagaggatgggcgctccgctgcagaacccg
cagcagccgcagcagcagtggactggaccggggattccaccccagcaacggcaggcgatg
atgaaccagatgagccatcaagccatgatggcagcgcactctccgctgcagcagcagcag
gtcctcaacatcttgcgctccaacccacagctcctggctgctttcatcaagcaacgagcc
tcaaaatacaagggcggacccggtggagcggacggcgtcccaggagggagtccaggcccc
gccggggggccagttggacacgccatgcctggagtcaacccacaggtgaacatgaacgct
gcgagcagccagccagggatgcatatggggggtcagggaggggccaacgtcaacatggcg
tccatgtctcagctgcagcaggggcagggattcatgggccaggggccccccggagcccca
caggggcagcaggcgcagggatacccggggtccgcccagcagcaaaggctgcagctacag
ctacagcagcagcagcagcagcagaacagcatggctgccctccaaagcggtgacgcgggt
ccaggaggtggaggcgttgctcagcaaccgcctcaaggcccgcagcctcctcaaggtggg
cccacccctccgtcttcccagacgcttttccaacaaactctgccgcagaggctgctgcag
caacagcagcagcagcacctcggccctggcagctcgcccgcccaacacagcaaccccatg
agcccccagcagccaccgcagcagatggctccgtcgccgcaccaccacctgcagggccag
gcgctgccgacgtcgctcgccaaccaggtgcgctcgccgcagccctcgccgcggccgcag
tcccagccgcctcactccagcccgtctccgcgcatgcagccccagccatcgccgcatcac
atctcgccgcaagtgcagacgggttcgccgcacccgggccacctgaaccagcaccaccct
gggatggtggtccccgcgccacagcagcagcagcagacaagccagcagcagaacgccatg
gagcagtttggctccgaccagagcgccatgctctcccagctaagcagcatggccggtctg
catgggccggccggcggtcctgacccgatgggccagaacatgaaccacaactccttagac
cacatgtag

DBGET integrated database retrieval system