KEGG   Xiphophorus maculatus (southern platyfish): 102236104Help
Entry
102236104         CDS       T02923                                 

Definition
(RefSeq) monoacylglycerol lipase abhd6-A-like
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102236104
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S33
   102236104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 235 aa AA seqDB search
MELRWAKKLLLTGGVLLVPVFALVTSVVFWPGVLLKAYNWYMCLSQGVAVCYSHSASYRF
CYSTRGTPGGATPTLLLLHGFSTSKEMWLSVIKYLPRNLHVVCLDMPGHEGTSRTGAEDY
SIQGQARRVHQFLRGLLANRIPNNNFYREVFLAIIGEKSRHSLQQHLNLITAPLQVIWGK
NDQILDVSGAAVIQKALPHCQVDLLDNCGHAIALERPRKFANIVLDFHNKAKKQA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggagctaaggtgggctaaaaaattattgctaacaggaggagttctgcttgttcctgtt
ttcgccctcgttacgtccgtggtgttctggcccggagtgctgctgaaggcctacaactgg
tacatgtgcctgtcgcagggcgtggcggtctgctactcccacagtgcaagttaccgcttc
tgttattccacccgcgggacaccagggggcgccacgccgacgctgctgctgctgcacggg
ttctccacctccaaggaaatgtggctgtctgtcatcaagtacctccccagaaacctgcat
gtggtttgtttggacatgcctggacatgaagggacgagtcgaactggtgcagaagattac
agcatccagggtcaggccaggcgagtccatcagttcctccggggccttctggccaacagg
atcccaaacaacaacttctacagagaagtgttcctggcgatcattggggagaaatctcgg
cactcgctgcaacaacacctgaatctgatcacagcgcccctgcaggtcatctgggggaag
aacgaccagatcctggatgtttctggagccgcggtgatccagaaggcgctgcctcactgc
caggtggatttgctggacaactgcggtcacgccattgccttggagaggccgaggaaattt
gctaacattgtgctggacttccacaataaagcaaagaaacaagcctga

DBGET integrated database retrieval system