KEGG   Xiphophorus maculatus (southern platyfish): 102236386Help
Entry
102236386         CDS       T02923                                 

Definition
sialidase-1-like
Orthology
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
Other glycan degradation
Sphingolipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102236386
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102236386
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102236386
Enzymes [BR:xma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102236386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 387 aa AA seqDB search
METGSWTSAGFLLLSALLSGCLCAYSPAQLDPLVFEEQLLWVSGAQGQVNTYRIPLITFT
PQGSLLAIAEGRKSSSGDIGAKFIAVRRSTDKGNTWSPTAFIVDDGSFTDGLNLGSVVVD
EEAGSVILIYSICFHLYHCKPASTMMVESWDDGLSWSRPKNLSVQLGVKAFAPGPGFGIQ
KRLDPAKGRLVVCGHGTIEGDGVFCILSDDHGETWRNGAALKSIPYNQPKKSQDFNPDEC
QPVELMDGSIMINVRNQNNYHCHCRIVVRSLDGGLTLPVEELFFDTALIDPAVAAGALQK
DGVLYFTNPSSDQKRVNLTLRWSLTNGKTWENKAVQIWPGPSGYSCLTSLNGDSVEDQKY
IFVIYEKGHKDIIETISFVKIHLYGGR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccggaagttggacttctgctgggttcttactgctcagcgcgctgctctccgga
tgtctttgtgcctacagcccggctcagcttgacccgctggtgtttgaggagcagctgctg
tgggtgagcggcgcccagggtcaagtgaacacctacagaatcccgctcatcacttttact
ccccaaggaagcctgctggccatcgccgagggcaggaagtcgtcgtccggtgacatagga
gcaaagtttatcgcagtgaggcgatccactgacaaaggaaacacctggtctccgaccgcc
ttcatagtggacgatggcagctttacggatggcttgaacctgggctccgtggttgtggac
gaagaggccggttcggtgattctgatctacagcatctgcttccacctgtaccactgcaag
ccggctagcaccatgatggtggagagctgggacgacggcctgagctggagccgacccaaa
aacctctcggtccagctgggagtgaaggctttcgctcctgggccgggattcggcatccag
aagcgccttgatcctgcaaaggggcggttggtggtgtgcggccatgggacgattgagggg
gacggagtgttttgcatcctgagcgacgatcatggagaaacgtggcgcaacggagcagcc
ctcaagagcatcccttacaaccaaccgaagaaatctcaggacttcaaccctgatgagtgc
cagccggttgagttgatggacggcagcatcatgatcaacgtccggaaccagaacaactac
cactgccactgccgcatcgtggtgcgcagcttggacggaggcctgactctccccgtagaa
gagctgttcttcgacaccgcgttgattgatcccgcagtcgcggctggagctctgcagaaa
gacggagtgctctacttcaccaacccgtccagcgaccaaaagagagtaaacctgacgcta
cgatggtcgctaacgaacggaaaaacctgggagaacaaagcagtccagatctggccgggg
ccgagcggctactcctgccttacatctctgaacggtgactctgtagaagaccagaaatac
atctttgtcatttatgagaagggccacaaggacatcattgagaccatctcgtttgtgaag
atccacctgtacggcgggcggtag

DBGET integrated database retrieval system