KEGG   Xiphophorus maculatus (southern platyfish): 102238107Help
Entry
102238107         CDS       T02923                                 

Definition
NAD-dependent protein deacetylase sirtuin-6-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102238107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 351 aa AA seqDB search
MSVNYAAGLSPYADKGVCGLPESFDSSEELKAKVETLAQLIKESEYLVVHSGAGISTSSG
IPDFRGPKGVWTLEEKGESPHFNTTFEDARPSLTHLALLGLQRAGYLKYLISQNVDGLHV
RSGFPRDKLSELHGNMFVEECEKCGRQYVREKVIGVMGLKPTGRYCEVVRSRGLRACRGK
LISTILDWEDALPDRDLNRADDASRRADLALTLGTSMQIKPSGDLPLLTKRKGGKVVIVN
LQPTKHDKHAHLRINGYVDDVMKQLMELLDLEIPKWEGPVICESSTFSPETTADVKPPRG
MSAKDKVKKDKIKEERKREATQPTEDAGVKDETVSVKRERADFSAETDEKE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgaattatgctgctggactctctccgtacgcagataaaggtgtctgcggactg
cctgagagtttcgacagttctgaggaactaaaggcaaaagtggagacccttgctcagctg
attaaagaatcggagtacttggtcgtccactctggagctggaattagcacctcatcaggc
attcctgacttcagaggtcccaagggtgtgtggacgctagaagaaaagggtgagtcacct
cactttaataccacatttgaagatgcccgccccagtttgactcacctggccctcctggga
ctgcaaagggcaggatacctgaaatacctcatcagccagaatgtcgacgggctgcatgtt
cgatcaggcttccccagggataaactatcagagcttcatggaaacatgtttgtggaggaa
tgcgagaagtgtggcaggcagtacgtgagggaaaaggtgatcggtgtgatggggctgaaa
ccgacaggacgttactgcgaggtggtgcggtccagagggctgagggcctgcagaggaaag
ctgatcagcaccatactggattgggaggatgctctgcctgacagagacctgaacagggca
gatgatgcaagcagacgagcagacctggcactgactctgggcacgtccatgcagatcaaa
cccagtggggacctcccactcctcacaaagcgcaaaggagggaaagtggttatagtcaac
ttgcaaccaaccaaacatgacaaacacgcccacctgcgtatcaacggttatgtggacgat
gtcatgaagcagctgatggagctgctggatttagaaatcccaaaatgggagggacccgtc
atctgcgagagctccactttctcacccgagaccaccgctgatgtcaagcctcctcgcggc
atgtctgcaaaggacaaagtgaaaaaggacaaaatcaaggaggaaaggaaaagggaagca
acgcagccaacggaggacgccggcgtgaaagacgagacggtttcagtaaagcgagagcga
gcagatttttccgcggagacagacgaaaaggaataa

DBGET integrated database retrieval system