KEGG   Xenorhabdus nematophila: XNC1_0042Help
Entry
XNC1_0042         CDS       T01274                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
xne  Xenorhabdus nematophila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    XNC1_0042 (rbsK)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     XNC1_0042 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
44599..45543
Genome map
AA seq 314 aa AA seqDB search
MSMAKLVVMGSINVDHILNLESFPQPGETVKGRQYQVAFGGKGANQAVAAGRCGADITFI
ACVGQDGIGEQVRQQLAKDNINTSSIECIEGETTGVALIFVNQQGENVIGINAGANGALT
PDYFRCYEQVVKDADALLLQLETPLETVQLAAETSKKHHTKVILNPAPAQKISAQLLSLV
DIITPNETEAECLTGITVKDDAGAKEAALALHDQGIETVIITLGSRGVWLSEKGKEGKIV
PGFKVKVIDTIAAGDTFNGALVTGLLEGKEMLSAIRFAHAAAAIAVTRQGAQPAVPWRHE
IDTFLSEQDSLWLP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggcaaaacttgtggtgatgggtagcattaatgtggatcacattttgaacctt
gaatcttttcctcaaccgggagaaaccgtaaaaggcaggcagtatcaggttgcatttgga
ggaaagggcgctaatcaggctgtggctgctggtcgttgcggtgctgacattacatttatt
gcctgtgttggtcaggatggtatcggcgaacaagtacgtcaacagttagcgaaagacaat
atcaatacttcatccattgagtgtattgaaggggagactacgggagtcgccctgattttt
gtcaaccagcaaggggagaatgtcattggtattaacgctggggcaaatggtgctctgacg
ccagattatttccgttgttatgagcaagtggtcaaagatgccgatgcgctattattacag
ttagaaacaccgttggaaacggtacaacttgctgctgaaacgtctaagaaacatcatacc
aaagtcattttgaaccccgcaccagcccaaaaaatatcagcccaattactttctctggtg
gatatcattacaccgaatgaaaccgaagcagaatgcctgacaggcattaccgtaaaagat
gatgcgggagcgaaggaagcggctctggccttacatgatcaaggtattgaaactgtcatt
attactttgggaagccgcggcgtatggttaagtgagaaaggcaaagaaggtaaaattgtt
cctggatttaaagtaaaagtgatcgatacgattgcagcaggagatacattcaatggtgcc
ttggtaacgggattgctggaaggaaaagagatgttgtcggcgatccgcttcgctcatgct
gcggctgcaattgctgtgactcgtcagggagcacagcctgcggtaccgtggcgacacgaa
attgatacatttctatctgaacaggactcactgtggctaccatga

DBGET integrated database retrieval system