KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0052Help
Entry
XNC1_0052         CDS       T01274                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase, has propionyl-CoA synthetase activity
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00010  Glycolysis / Gluconeogenesis
xne00620  Pyruvate metabolism
xne00640  Propanoate metabolism
xne00680  Methane metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_0052 (acs)
   00620 Pyruvate metabolism
    XNC1_0052 (acs)
   00640 Propanoate metabolism
    XNC1_0052 (acs)
  Energy metabolism
   00680 Methane metabolism
    XNC1_0052 (acs)
Enzymes [BR:xne01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XNC1_0052 (acs)
Lipid biosynthesis proteins [BR:xne01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XNC1_0052 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF4157
Motif
Other DBs
NCBI-ProteinID: CBJ88140
UniProt: D3VG50
Position
complement(55744..57699)
Genome map
AA seq 651 aa AA seqDB search
MTQIIKHLIPADIADSALISKQQYLQDYQWSLQDPEGFWGEKGKIVDWITPYTKVKNTSF
DPGHISIRWFEDGTLNLSANCLDRHLQERGDQTAIIWEGDNPAESRHVTYRELHHDVCQF
ANVLKKLGIQKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPDAIAGRVIDSNA
KLIVTADEGLRAGRTIPLKKNVDEALNNSAVTSVTNVVIFKRTGNTKNWYDGRDLWWHEL
INSVSTDCPAEEMNAEDPLFILYTSGSTGKPKGVLHTSGGYLVYASLTFKYTFDYRPGEI
YWCTADIGWVTGHSYLLYGPLSCGATTLMFEGVPNYPDVNRLCQVIDKHQVNILYTAPTA
IRALMAEGDKAIEETKRTSLRILGSVGEPINPEAWEWYYKKIGNSKCPIVDTWWQTETGG
FMITPLPGATDLKAGSATLPFFGVSPALVDNSGEILEGENEGNLVITDSWPAQARTLYGD
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNISGHRLGTAEIESALVSHP
KIAEAAVVGIPHHIKGQAIYAYVTLIHGEEPSPALYSEVRSWVRKEIGPIATPDILHWTD
SLPKTRSGKIMRRILRKIASGDTSNLGDTSTLADPGVVDKLLEEKQSIKIS
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaataatcaagcatcttattcctgctgacattgcagattccgccctgataagt
aagcaacaatatctacaagactaccaatggtcactgcaagatcctgaaggattttggggc
gagaaagggaagattgtggattggataacaccttacaccaaggtcaaaaatacctctttc
gatccagggcatatcagtattcgttggtttgaagatggcactttgaatttaagtgccaat
tgccttgatcgccatttacaagagcgtggtgatcaaacggccattatctgggaaggggat
aaccccgcagaatcccgccatgttacgtatcgtgaattacatcatgacgtctgccaattc
gccaatgtgttgaagaaactcggtatccaaaaaggagacgtcgtcgctatttatatgcca
atggtaccagaagccgcagttgcgatgctggcttgtgctcgtatcggggcgatccattcc
gtcattttcggtggtttctctcctgatgccatcgctggcagagttatcgattctaatgcc
aaacttattgttaccgcagatgaaggtttgcgagctggccgcacaatcccattgaaaaag
aatgtcgatgaagcactgaacaattctgccgtgactagcgttacaaatgtggttatcttc
aagcgtaccggaaatacgaaaaactggtatgacggccgtgatctatggtggcatgaactt
atcaacagtgtcagtacagattgccccgctgaagagatgaatgccgaagatccattattc
atcctctatacctctggctcaacaggaaaacccaaaggggttctgcataccagtggcggt
tatctggtttacgcctctttaacttttaaatacacgtttgattaccgccccggagaaatc
tactggtgcacggcggatatcggctgggtaacaggacacagttacctgctgtatgggcca
ttatcttgcggtgcgacaacgttaatgtttgaaggtgtgcccaactatcccgatgttaat
cgtttatgtcaggttattgataaacatcaggttaatattctttataccgccccaacggcc
atcagggcattaatggcggaaggtgataaggccatagaagaaaccaaacgcacttcattg
cgtatcttgggatctgttggtgagccaattaatccagaagcatgggagtggtattacaaa
aagataggtaacagtaaatgccctatcgtggatacttggtggcaaactgaaacaggcggc
ttcatgatcacgccattgcccggtgcgactgacctcaaagccggttccgctactctgcca
ttctttggtgtcagtccggctctggtcgataactccggggaaattttagagggagagaac
gaaggcaacctcgtcatcacagattcctggccagcccaagcccggactttatatggcgat
catgagcgtttcgaacaaacctatttttccacctttaaaggaatgtatttcagtggtgat
ggtgcccggcgtgatgaagacggctattactggataacaggccgagtcgatgatgtgctg
aatatttcaggacatcgtttgggaacagcagaaatagagtcagcgctggtttctcatcct
aaaattgcagaagccgcagtcgtcggtattcctcatcatatcaaagggcaggccatatat
gcctatgtcacgctaattcatggtgaagagccttctcctgctctttatagcgaagtcaga
agttgggtgcgtaaagaaatcggcccgatagcaacaccggatatcctgcactggacagat
tctctaccaaaaacgcgttcaggcaagatcatgcggcgtattttgcgcaaaattgcttca
ggtgataccagtaacttaggagatacttccactctggcagatccgggagtcgttgataag
ctgctggaagaaaagcaatctatcaagatatcgtaa

DBGET integrated database retrieval system