KEGG   Xenorhabdus nematophila: XNC1_0100Help
Entry
XNC1_0100         CDS       T01274                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xne  Xenorhabdus nematophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNC1_0100 (pfkA)
   01230 Biosynthesis of amino acids
    XNC1_0100 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_0100 (pfkA)
   00030 Pentose phosphate pathway
    XNC1_0100 (pfkA)
   00051 Fructose and mannose metabolism
    XNC1_0100 (pfkA)
   00052 Galactose metabolism
    XNC1_0100 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XNC1_0100 (pfkA)
Enzymes [BR:xne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XNC1_0100 (pfkA)
Protein phosphatases and associated proteins [BR:xne01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XNC1_0100 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(98387..99364)
Genome map
AA seq 325 aa AA seqDB search
MINKIKRIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYLGLYENRMKKLDRFS
VSDMINRGGTFLGSARFPEFRDDKVREIAIENMRKNGIEALVVIGGDGSYLGAKKLTEAG
FPCIGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHKRISIVEVMGRYCGDL
TLSAAIAGGCEFIVLPECETPFDREELLAEIKAGIEKGKRHAIVAITEHVCDVGELAKYI
EAETRHETRATVLGHIQRGGAPVAYDRILASRMGAYSVQLLLEGCGGRCVGIQNEKLVHH
DIIDAVQNMQRIFKKDWLETAKKLY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacaagattaaaagaatcggagtcttaacgagtggcggtgatgcgcctggcatg
aacgccgctattcgtggtgttgttcgtgccgctttaaccgaagggttagaagtctacggc
atttatgatggctatctggggttgtatgaaaaccgcatgaagaagctggaccgctttagc
gtttccgacatgataaaccggggcggcacatttttagggtcggcccgtttccctgaattc
agggatgataaagtccgggagattgccattgaaaatatgcgcaaaaacggcattgaagca
ctggtcgtcattggtggtgacggttcttatttaggtgcgaaaaaactgactgaggcaggc
ttcccttgtatcggcttaccgggaacgattgacaacgatgtcgccggcacagattacacc
atcggttatttcactgcgctggaaacagtcgttgaagcaatcgaccgcttgcgtgataca
tcaacctcccacaaacgcatctcgattgttgaagtaatggggcgttattgcggtgattta
accttatcggccgccattgcgggtggatgtgaatttattgtactgcctgaatgtgaaacg
ccgtttgatcgtgaagaattgctggctgaaattaaagcagggattgaaaaaggcaagcgt
catgcgattgttgccatcactgagcatgtttgcgatgttggtgaattggcaaaatatatt
gaagcagaaacccgccacgaaacccgggcaacggtattaggacacattcagcgcggcggt
gcgccggtggcttatgaccgtattctggcttcccgcatgggcgcttattccgtgcagtta
ctgctggaagggtgcggcggtcgttgtgttggtatccagaacgagaaacttgttcatcac
gatattattgacgcggtgcaaaatatgcagcgtatctttaagaaagactggctggaaacc
gcgaagaaactctactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system