KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0208Help
Entry
XNC1_0208         CDS       T01274                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00010  Glycolysis / Gluconeogenesis
xne00051  Fructose and mannose metabolism
xne00562  Inositol phosphate metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
xne01230  Biosynthesis of amino acids
Module
xne_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
xne_M00002  Glycolysis, core module involving three-carbon compounds
xne_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_0208 (tpiA)
   00051 Fructose and mannose metabolism
    XNC1_0208 (tpiA)
   00562 Inositol phosphate metabolism
    XNC1_0208 (tpiA)
Enzymes [BR:xne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XNC1_0208 (tpiA)
Exosome [BR:xne04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XNC1_0208 (tpiA)
  Exosomal proteins of bladder cancer cells
   XNC1_0208 (tpiA)
  Exosomal proteins of melanoma cells
   XNC1_0208 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBJ88296
UniProt: D3VH11
Position
complement(183070..183837)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGNTHMVNDLIAGLRKELSNVDGCGVAIAPPTVYVSLAKNALAGSRIA
LGAQDVGVNLSGAFTGETSAEMLKDVGAQYIIIGHSERRTYHKESDEFIAKKFAILKEQG
LIPVLCIGETEQENEDGQTEVVCARQIDAVLNTLGAEAFKGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaaattaaatggcaatacccacatggttaac
gacctgattgcaggcctgcgtaaagaactgagcaacgttgacggctgtggcgtcgctatt
gcaccaccaacagtttatgtttctctggcaaaaaatgcgttggcaggcagccgtatcgct
ctgggcgctcaagatgttggcgtaaatctttccggcgcatttacaggtgaaacgtccgct
gaaatgctgaaagacgttggcgcacaatatatcattatcggtcactcagaacgccggact
taccacaaagaaagcgatgaattcattgccaaaaaattcgcaattctgaaagaacaaggc
ctgatcccggttctgtgtatcggtgagactgaacaagaaaatgaagatggtcagaccgaa
gtcgtttgtgcccgccaaattgatgccgtcctgaacacgctgggtgcagaagcattcaaa
ggtgcggttatcgcctacgaacctgtttgggcaatcggcactggtaagtctgcaacgcct
gctcaggcgcaagcggttcacaaattcatccgcgaccacatcgcgaagcaagatgccgct
atcgctgaacaagttatcattcaatacggtggttccgtcaacgccggcaatgccgcagag
ctgttcactcagccggatatcgacggcgcgctggtcggtggtgcatcattgaaagccgat
gctttcgcagtcatcgtcaaagccgcagcagaagcgaaaaaagcataa

DBGET integrated database retrieval system