KEGG   Xenorhabdus nematophila: XNC1_0473Help
Entry
XNC1_0473         CDS       T01274                                 

Gene name
cysQ
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
xne  Xenorhabdus nematophila
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xne00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
403985..404728
Genome map
AA seq 247 aa AA seqDB search
MLQQICQLAREAGAAIMEVYQAEQPLQVEHKTDDSPVTAADIAAHKIIKAGLLRIAPDIP
LLSEEDPPVWEERKNWRRYWLVDPLDGTKEFIRRNGEFTVNIALIEDGVPVMGVVYVPVQ
NVLYSGQGHQARKEANGQILPIKVISAALPVVVVSRSHRDDEELQDYLSQLGVHNTLSIG
SSLKFCMVAEGKAQLYPRFGPTNIWDTGAGHAVAIAAGAHVTDWEGKTLNYSPRESFLNP
GFRVSIF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctacaacagatctgccaattggcacgagaagcaggggctgcgatcatggaagtctat
caggctgagcaaccgttgcaagtagagcacaagacggatgattcaccagtcactgctgcg
gatattgccgcccataagattattaaagctggattattgcgtattgcgcctgatatcccg
ttgctgtcagaagaagacccacctgtatgggaagaacggaaaaactggcgacgttattgg
ctggttgacccattggatggcacaaaagaatttatccgccgaaatggcgagtttaccgtt
aatatcgcattgattgaggacggcgtacctgtgatgggggttgtttatgttccggtgcag
aatgttctgtattcagggcaaggccatcaggcccgcaaggaagccaatggacaaattctg
cctattaaagttatttctgctgcgctcccagtcgtcgttgtcagccgttctcaccgagat
gatgaagaattgcaagattacctctcccagttaggtgttcacaatacactttcgataggc
tcttcacttaaattttgtatggtggcggaaggaaaagctcagctttatcctcgttttggg
ccaaccaatatttgggatacgggagcgggtcatgctgttgcgattgccgcaggtgcgcat
gttaccgactgggaagggaagacgctgaattactcgccgcgtgaatctttcctgaatcct
ggatttagggtcagtattttttaa

DBGET integrated database retrieval system