KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0548Help
Entry
XNC1_0548         CDS       T01274                                 

Definition
(RefSeq) hypothetical protein
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XNC1_0548
Enzymes [BR:xne01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     XNC1_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(472940..473461)
Genome map
AA seq 173 aa AA seqDB search
MTAGAIQSNHVRQTAAIAAKYGLKCVALLENPIRNQDSNFLNNGNKLLTELFNAQCVMCN
ELTDPNVQMKALINQFKLEDAYIIPVGGSDVLLWDNYFAPMYGMPNKKGLDAITLLAQKE
GILLDPVYTGKAMAGLIDNVLNNTIDSQKPLLFVHTGGAPALFAYSGIDAIID
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccggggcaattcaatcaaatcatgtacggcaaacagcagctattgctgcaaaa
tacggtctaaaatgtgtcgccttattagagaatccaatccgaaatcaagatagtaatttt
ctgaataatggcaataaactgctgacagaattatttaacgcccaatgtgtcatgtgcaat
gaattaaccgatcccaatgtgcaaatgaaggcattgattaaccagttcaagctcgaagat
gcttatattattcccgtcggcggttcagatgttcttttatgggataattattttgctccc
atgtatggcatgccaaataaaaaggggttagacgccattacgctattggcacaaaaagag
ggcattttattagatcccgtctataccggaaaagcgatggccgggttaattgataatgta
ctgaataataccattgacagtcagaagccattgctctttgttcataccggtggagcgcct
gcattgtttgcctattccggaatcgatgcaataatagattga

DBGET integrated database retrieval system