KEGG   Xenorhabdus nematophila: XNC1_0548Help
Entry
XNC1_0548         CDS       T01274                                 

Definition
hypothetical protein
Organism
xne  Xenorhabdus nematophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(472940..473461)
Genome map
AA seq 173 aa AA seqDB search
MTAGAIQSNHVRQTAAIAAKYGLKCVALLENPIRNQDSNFLNNGNKLLTELFNAQCVMCN
ELTDPNVQMKALINQFKLEDAYIIPVGGSDVLLWDNYFAPMYGMPNKKGLDAITLLAQKE
GILLDPVYTGKAMAGLIDNVLNNTIDSQKPLLFVHTGGAPALFAYSGIDAIID
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccggggcaattcaatcaaatcatgtacggcaaacagcagctattgctgcaaaa
tacggtctaaaatgtgtcgccttattagagaatccaatccgaaatcaagatagtaatttt
ctgaataatggcaataaactgctgacagaattatttaacgcccaatgtgtcatgtgcaat
gaattaaccgatcccaatgtgcaaatgaaggcattgattaaccagttcaagctcgaagat
gcttatattattcccgtcggcggttcagatgttcttttatgggataattattttgctccc
atgtatggcatgccaaataaaaaggggttagacgccattacgctattggcacaaaaagag
ggcattttattagatcccgtctataccggaaaagcgatggccgggttaattgataatgta
ctgaataataccattgacagtcagaagccattgctctttgttcataccggtggagcgcct
gcattgtttgcctattccggaatcgatgcaataatagattga

DBGET integrated database retrieval system