KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_1080Help
Entry
XNC1_1080         CDS       T01274                                 

Gene name
aceE
Definition
(GenBank) pyruvate dehydrogenase, decarboxylase subunit, thiamin-binding
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
xne  Xenorhabdus nematophila ATCC 19061
Pathway
xne00010  Glycolysis / Gluconeogenesis
xne00020  Citrate cycle (TCA cycle)
xne00620  Pyruvate metabolism
xne01100  Metabolic pathways
xne01110  Biosynthesis of secondary metabolites
xne01120  Microbial metabolism in diverse environments
xne01130  Biosynthesis of antibiotics
xne01200  Carbon metabolism
Module
xne_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_1080 (aceE)
   00020 Citrate cycle (TCA cycle)
    XNC1_1080 (aceE)
   00620 Pyruvate metabolism
    XNC1_1080 (aceE)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     XNC1_1080 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: CBJ89151
UniProt: D3V8V3
Position
956870..959533
Genome map
AA seq 887 aa AA seqDB search
MSDMLKNDVDPIETRDWLQAIESVIREEGVERAQFLIDQVLSEARKGGVNVAAGAASRDY
INTIPVEDEPAYPGNLNLERRIRSAIRWNAVMTVLRASKKDLELGGHMASFQSSATVYDV
CFNHFFRARNENDGGDLVYFQGHISPGVYARAFLEGRLTEEQMNNFRQEIGGNGLSSYPH
PKLMPDFWQFPTVSMGLGPISAIYQAKFLKYLENRGLKDTSKQTVYAFLGDGEMDEPESK
GAITIATREKLDNLVFIINCNLQRLDGPVTGNGKIVNELEGIFDGAGWQVLKVLWGERWD
ALLRKDNSGKLVQLMNETLDGDYQTFKSKDGAYVREHFFGRYPETAALVKDMTDDEIWAL
NRGGHDPKKVYAALQKAQNTTGKPTVILAQTVKGYGMGDTAEGKNIAHQVKKMNMEGVCL
FRDRFNVPVSDEQIEKLPYVTFEKDSEESKYLHERRNALGGYLPSRRVNFDEKLEIPALE
DFSSLLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQQYTPQDREQVAYYKEDAKGQILQEGINELGAASSWLAAATSYSTNNLPMIPFYIYY
SMFGFQRIGDLCWAAGDQQARGFLVGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAFAYEVAVIMHDGLERMYGEKQENIYYYITTLNENYHMPAMPAGAEEGIRKGIYKLESL
EGGKGKVQLLGSGSILRHVREAAKILSDEYGIGSDVYSVTSFTELARDGQDCERWNMLHP
SEAPRVPYITQIMNEAPAIASTDYMKLFAEQVRNFVPASDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEVDVKVVEEAITKYNINPEKVNPRLA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatgttgaaaaatgacgtggatccgatcgaaactcgcgattggttacaggcg
atcgaatcggtcatccgtgaagaaggtgttgagcgtgctcagttcctgattgatcaggtt
ttgagtgaagctcgtaaaggtggcgttaacgttgctgcaggtgctgcaagccgtgattac
atcaacactattcctgttgaggatgagcctgcttaccctggcaacctgaatttggagcgc
cgtattcgctctgctattcgctggaacgcagtgatgactgttctgcgcgcatccaaaaaa
gatctggaactgggtggtcacatggcttcattccagtcttccgctactgtttatgatgtg
tgttttaaccacttcttccgcgcgcgtaacgagaatgatggtggtgacttggtttacttc
cagggccacatttctccgggtgtttatgcccgtgccttccttgaaggtcgtctgactgaa
gaacagatgaacaacttccgtcaggaaattggtggtaatggtctgtcttcttacccgcat
ccaaaactgatgcctgacttctggcagttcccaacggtttctatgggtctggggccaatc
tccgctatttatcaggctaagttcctgaaatatctggaaaatcgtggtctgaaagatacg
tctaaacaaaccgtttacgctttcttgggcgacggtgaaatggatgagccagaatccaaa
ggtgcgatcactatcgcaactcgtgaaaaactggataacctggtatttatcatcaactgt
aacttgcagcgtctggatggcccagtcactggtaacggtaaaatcgttaacgaactggaa
ggtatcttcgacggtgctggctggcaggtactgaaagtcctgtggggcgagcgttgggat
gcgttgctgcgtaaagataacagcggtaaactggttcagttgatgaacgaaacgctggac
ggcgactatcagacattcaagtctaaagatggcgcttatgttcgtgaacacttcttcggt
cgctaccctgaaactgcggcattggtcaaagacatgactgatgacgaaatctgggctctg
aaccgtggcggtcatgatcctaagaaagtatacgctgcactgcaaaaagcgcagaatact
acgggtaaaccaactgtaatcctggctcagactgtcaaaggttacggtatgggtgacact
gctgaaggcaagaacattgctcatcaggttaagaaaatgaatatggaaggcgtttgtctg
ttccgtgatcgtttcaatgtgcctgtatctgacgagcaaatcgaaaaactgccatatgtc
actttcgagaaagattctgaagagtctaaatacctgcacgagcgtcgcaacgcactgggt
ggttacctgccaagccgtcgtgttaatttcgacgaaaaactggaaattccagcgctggaa
gacttcagctctctgctggaagaacaatccaaagaaatttctaccactatcgctttcgtt
cgtgcgctgaacgttatgttgaagaataagtcgattaaagatcgtctggttcctatcatt
gctgacgaagcacgtactttcggtatggaaggtctgttccgtcaaatcggtatctacagc
ccgaatggtcagcagtatactccgcaagaccgtgagcaggttgcttattataaagaagac
gccaagggtcagatcctgcaagaaggtatcaacgaactgggtgctgcttcatcttggctg
gcggctgcaacttcttacagtaccaacaatctgccaatgatcccgttctacatctattac
tccatgttcggattccagcgtatcggtgatctgtgctgggcggcaggtgaccaacaggct
cgcggcttcctggtcggtggtacttctggtcgtacgactctgaacggtgaaggtttgcag
cacgaagatggtcacagccacattcagtctctgactatccctaactgtatctcttatgat
cctgcattcgcttatgaagttgctgttatcatgcatgatggcctggagcgcatgtatggt
gagaaacaagagaacatctactactacatcactaccctgaacgaaaactaccatatgcca
gcaatgcctgcgggtgctgaagaaggtatccgtaaaggtatctacaagctggaaagccta
gaaggcggtaaaggtaaagttcagttgctgggttctggctctatactgcgccatgttcgt
gaagcagcgaagatcctgtctgacgagtacggtattggttctgacgtatacagcgtaact
tccttcactgaactggctcgtgacggtcaggattgtgaacgctggaacatgctgcaccca
tcagaagccccacgtgtaccttatattactcagatcatgaacgaagcgccagcgattgct
tctactgactacatgaaactgtttgcagaacaagtacgtaacttcgttccagcaagcgac
tatcgtgtactgggtactgacggtttcggtcgttctgacagccgtgaaaacctgcgtcac
cacttcgaagttgatgcttcttacgtggttgttgccgctctgggtgagttggctaaacgt
ggcgaagttgatgtgaaagtggttgaagaagccatcactaaatacaacatcaacccagaa
aaagttaacccacgtctggcataa

DBGET integrated database retrieval system