KEGG   Xenorhabdus nematophila: XNC1_1080Help
Entry
XNC1_1080         CDS       T01274                                 

Gene name
aceE
Definition
pyruvate dehydrogenase, decarboxylase subunit, thiamin-binding (EC:1.2.4.1)
Orthology
K00163  
pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
xne  Xenorhabdus nematophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:xne00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XNC1_1080 (aceE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC1_1080 (aceE)
   00020 Citrate cycle (TCA cycle)
    XNC1_1080 (aceE)
   00620 Pyruvate metabolism
    XNC1_1080 (aceE)
Enzymes [BR:xne01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     XNC1_1080 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956870..959533
Genome map
AA seq 887 aa AA seqDB search
MSDMLKNDVDPIETRDWLQAIESVIREEGVERAQFLIDQVLSEARKGGVNVAAGAASRDY
INTIPVEDEPAYPGNLNLERRIRSAIRWNAVMTVLRASKKDLELGGHMASFQSSATVYDV
CFNHFFRARNENDGGDLVYFQGHISPGVYARAFLEGRLTEEQMNNFRQEIGGNGLSSYPH
PKLMPDFWQFPTVSMGLGPISAIYQAKFLKYLENRGLKDTSKQTVYAFLGDGEMDEPESK
GAITIATREKLDNLVFIINCNLQRLDGPVTGNGKIVNELEGIFDGAGWQVLKVLWGERWD
ALLRKDNSGKLVQLMNETLDGDYQTFKSKDGAYVREHFFGRYPETAALVKDMTDDEIWAL
NRGGHDPKKVYAALQKAQNTTGKPTVILAQTVKGYGMGDTAEGKNIAHQVKKMNMEGVCL
FRDRFNVPVSDEQIEKLPYVTFEKDSEESKYLHERRNALGGYLPSRRVNFDEKLEIPALE
DFSSLLEEQSKEISTTIAFVRALNVMLKNKSIKDRLVPIIADEARTFGMEGLFRQIGIYS
PNGQQYTPQDREQVAYYKEDAKGQILQEGINELGAASSWLAAATSYSTNNLPMIPFYIYY
SMFGFQRIGDLCWAAGDQQARGFLVGGTSGRTTLNGEGLQHEDGHSHIQSLTIPNCISYD
PAFAYEVAVIMHDGLERMYGEKQENIYYYITTLNENYHMPAMPAGAEEGIRKGIYKLESL
EGGKGKVQLLGSGSILRHVREAAKILSDEYGIGSDVYSVTSFTELARDGQDCERWNMLHP
SEAPRVPYITQIMNEAPAIASTDYMKLFAEQVRNFVPASDYRVLGTDGFGRSDSRENLRH
HFEVDASYVVVAALGELAKRGEVDVKVVEEAITKYNINPEKVNPRLA
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatgttgaaaaatgacgtggatccgatcgaaactcgcgattggttacaggcg
atcgaatcggtcatccgtgaagaaggtgttgagcgtgctcagttcctgattgatcaggtt
ttgagtgaagctcgtaaaggtggcgttaacgttgctgcaggtgctgcaagccgtgattac
atcaacactattcctgttgaggatgagcctgcttaccctggcaacctgaatttggagcgc
cgtattcgctctgctattcgctggaacgcagtgatgactgttctgcgcgcatccaaaaaa
gatctggaactgggtggtcacatggcttcattccagtcttccgctactgtttatgatgtg
tgttttaaccacttcttccgcgcgcgtaacgagaatgatggtggtgacttggtttacttc
cagggccacatttctccgggtgtttatgcccgtgccttccttgaaggtcgtctgactgaa
gaacagatgaacaacttccgtcaggaaattggtggtaatggtctgtcttcttacccgcat
ccaaaactgatgcctgacttctggcagttcccaacggtttctatgggtctggggccaatc
tccgctatttatcaggctaagttcctgaaatatctggaaaatcgtggtctgaaagatacg
tctaaacaaaccgtttacgctttcttgggcgacggtgaaatggatgagccagaatccaaa
ggtgcgatcactatcgcaactcgtgaaaaactggataacctggtatttatcatcaactgt
aacttgcagcgtctggatggcccagtcactggtaacggtaaaatcgttaacgaactggaa
ggtatcttcgacggtgctggctggcaggtactgaaagtcctgtggggcgagcgttgggat
gcgttgctgcgtaaagataacagcggtaaactggttcagttgatgaacgaaacgctggac
ggcgactatcagacattcaagtctaaagatggcgcttatgttcgtgaacacttcttcggt
cgctaccctgaaactgcggcattggtcaaagacatgactgatgacgaaatctgggctctg
aaccgtggcggtcatgatcctaagaaagtatacgctgcactgcaaaaagcgcagaatact
acgggtaaaccaactgtaatcctggctcagactgtcaaaggttacggtatgggtgacact
gctgaaggcaagaacattgctcatcaggttaagaaaatgaatatggaaggcgtttgtctg
ttccgtgatcgtttcaatgtgcctgtatctgacgagcaaatcgaaaaactgccatatgtc
actttcgagaaagattctgaagagtctaaatacctgcacgagcgtcgcaacgcactgggt
ggttacctgccaagccgtcgtgttaatttcgacgaaaaactggaaattccagcgctggaa
gacttcagctctctgctggaagaacaatccaaagaaatttctaccactatcgctttcgtt
cgtgcgctgaacgttatgttgaagaataagtcgattaaagatcgtctggttcctatcatt
gctgacgaagcacgtactttcggtatggaaggtctgttccgtcaaatcggtatctacagc
ccgaatggtcagcagtatactccgcaagaccgtgagcaggttgcttattataaagaagac
gccaagggtcagatcctgcaagaaggtatcaacgaactgggtgctgcttcatcttggctg
gcggctgcaacttcttacagtaccaacaatctgccaatgatcccgttctacatctattac
tccatgttcggattccagcgtatcggtgatctgtgctgggcggcaggtgaccaacaggct
cgcggcttcctggtcggtggtacttctggtcgtacgactctgaacggtgaaggtttgcag
cacgaagatggtcacagccacattcagtctctgactatccctaactgtatctcttatgat
cctgcattcgcttatgaagttgctgttatcatgcatgatggcctggagcgcatgtatggt
gagaaacaagagaacatctactactacatcactaccctgaacgaaaactaccatatgcca
gcaatgcctgcgggtgctgaagaaggtatccgtaaaggtatctacaagctggaaagccta
gaaggcggtaaaggtaaagttcagttgctgggttctggctctatactgcgccatgttcgt
gaagcagcgaagatcctgtctgacgagtacggtattggttctgacgtatacagcgtaact
tccttcactgaactggctcgtgacggtcaggattgtgaacgctggaacatgctgcaccca
tcagaagccccacgtgtaccttatattactcagatcatgaacgaagcgccagcgattgct
tctactgactacatgaaactgtttgcagaacaagtacgtaacttcgttccagcaagcgac
tatcgtgtactgggtactgacggtttcggtcgttctgacagccgtgaaaacctgcgtcac
cacttcgaagttgatgcttcttacgtggttgttgccgctctgggtgagttggctaaacgt
ggcgaagttgatgtgaaagtggttgaagaagccatcactaaatacaacatcaacccagaa
aaagttaacccacgtctggcataa

DBGET integrated database retrieval system